DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7206 and SMG6

DIOPT Version :9

Sequence 1:NP_996499.1 Gene:CG7206 / 32788 FlyBaseID:FBgn0030892 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_060045.4 Gene:SMG6 / 23293 HGNCID:17809 Length:1419 Species:Homo sapiens


Alignment Length:391 Identity:90/391 - (23%)
Similarity:148/391 - (37%) Gaps:118/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PQRLLKFPPKVAMNAW----------------EKP----------KALVDANRLKAGRTQTAYQR 124
            |...|..|..||::.|                |.|          ..:::.:||.:|        
Human  1043 PPTSLDLPSHVAVDVWSTLADFCNILTAVNQSEVPLYKDPDDDLTLLILEEDRLLSG-------- 1099

  Fly   125 LMLLRASLQQKQLYEERNNNIVAKINEE--VIEKQPEA-CNITNP-SAFDGST-ASDMEVEPMEW 184
            .:.|.|:.|.....|:.::.::|...:.  |::...|| |....| .||.|.. .|...|.....
Human  1100 FVPLLAAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVPDTMG 1164

  Fly   185 QESIEEEAAQNDQDEAKKGDDTLLMLPAESIEEEAPQK---GQDEAKEEDDTILML------QAA 240
            :|...:|..:.:.:|    :|.::    |..||::..:   |:|:.:|.....|.|      |..
Human  1165 KEMGSQEGTRLEDEE----EDVVI----EDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQR 1221

  Fly   241 DAEELPPRLEDY------------MYFVLDTNVLIHNHKFVERLTDVVLPGTVGSMLYLPYIVIK 293
            ..|::...|||:            ::.|.|||..|.:...:.||.:     :...:|.:|.|||.
Human  1222 RQEKIQAVLEDHSQMRQMELEIRPLFLVPDTNGFIDHLASLARLLE-----SRKYILVVPLIVIN 1281

  Fly   294 ELDKLKSKYQSD----CLQRVI---AMRAIRFLNTKFD----------------ESFQIQAQSAL 335
            |||.|....::|    ...||:   |.::|.||..:|:                ||.      |.
Human  1282 ELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESI------AF 1340

  Fly   336 EEADHLIKIDCPDDSILNCCLQ-----------LQAQVP-----HMILLTNDANLRLKANASNIQ 384
            ...|...::...||.||:|||.           ...:.|     .::|||:|.|||:||...|:.
Human  1341 RSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVP 1405

  Fly   385 V 385
            |
Human  1406 V 1406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7206NP_996499.1 PIN_Smg5-Smg6-like 254..392 CDD:189050 47/171 (27%)
SMG6NP_060045.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..79
EJC-binding motif 1, mediates interaction with the EJC 39..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..165
Interaction with telomeric DNA 114..503
EJC-binding motif 2, mediates interaction with the EJC 133..153
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..405
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..472
EST1 638..741 CDD:287360
EST1_DNA_bind 751..1103 CDD:287359 11/67 (16%)
TPR repeat 765..795 CDD:276809
TPR repeat 800..823 CDD:276809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 854..883
PIN_Smg6 1241..1416 CDD:189055 47/177 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1427
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.