DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7206 and ZK1248.15

DIOPT Version :9

Sequence 1:NP_996499.1 Gene:CG7206 / 32788 FlyBaseID:FBgn0030892 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_495162.1 Gene:ZK1248.15 / 173991 WormBaseID:WBGene00022883 Length:471 Species:Caenorhabditis elegans


Alignment Length:285 Identity:59/285 - (20%)
Similarity:106/285 - (37%) Gaps:74/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 TNPSAFD-GSTASDMEVEPMEWQESIEEEAAQN---DQDEAKKGDDTLLMLPAESIEE------- 217
            |..|.:| .:|..:.|..|::.:....::..:|   ..|:.|...|.:.....:|:|:       
 Worm    41 TKESLWDHPNTRKNEEKSPVKAKTRKRKDVEENIHGTMDDDKMEVDVVPPPKRKSMEKLDDEEFS 105

  Fly   218 -EAPQKGQDE---AKEEDDTILMLQAADAEELPPRL---------EDYMY---FVLDTNVLIHNH 266
             :.|::....   .|:||........:.:.::.||:         :|..|   .:.||..|:.| 
 Worm   106 WKRPRRSDSSERITKKEDIPSCSGVESHSNKMLPRVPWSSEVRPFKDLHYRACAIFDTCALLGN- 169

  Fly   267 KFVERLTDVVLPGTVGSML-YLPYIVIKELDKLK-----SKYQSDCLQRVIAMRAIRFL------ 319
                  .||:.......:| .:||..:.|||.||     ::..::|     |..:|:.|      
 Worm   170 ------PDVLNASIEKQILTVIPYFTLSELDGLKNGSGHTRIVANC-----ANNSIKDLLEEKNQ 223

  Fly   320 ----NTKFDESFQIQAQSALEEADHLIKIDCPDDSILNCCLQLQAQVPH-----------MILLT 369
                .|..::..||...||        .....||.||...|:::.::..           :||:|
 Worm   224 YLHVETSTEQQIQINGFSA--------NTTVVDDLILRTALRIKREIMSIPSTMNLNDRAIILVT 280

  Fly   370 NDANLRLKANASNIQVSCRSDLMST 394
            .|.||..||...::.|......|.|
 Worm   281 EDVNLSNKALTHDLHVETVKSFMDT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7206NP_996499.1 PIN_Smg5-Smg6-like 254..392 CDD:189050 38/167 (23%)
ZK1248.15NP_495162.1 WW 21..49 CDD:197736 3/7 (43%)
PIN_Smg5-6-like 160..304 CDD:350228 37/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_142489
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.