powered by:
Protein Alignment CG7536 and VTC1
DIOPT Version :9
Sequence 1: | NP_001285398.1 |
Gene: | CG7536 / 32786 |
FlyBaseID: | FBgn0030890 |
Length: | 674 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010995.1 |
Gene: | VTC1 / 856803 |
SGDID: | S000000874 |
Length: | 129 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 26/71 - (36%) |
Gaps: | 18/71 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 329 LAIPAFINPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPFFHVGFADFWLGDQLNSLA 393
:|:|..:.| .:|.|| :..|..| ....|......||..:| ||::..::
Yeast 15 IALPTRVEP-------KVFFAN-------ERTFLSW--LNFTVMLGGLGVGLLNF--GDKIGRVS 61
Fly 394 TAILDF 399
..:..|
Yeast 62 AGLFTF 67
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157343548 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.