DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7536 and VTC1

DIOPT Version :9

Sequence 1:NP_001285398.1 Gene:CG7536 / 32786 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_010995.1 Gene:VTC1 / 856803 SGDID:S000000874 Length:129 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:15/71 - (21%)
Similarity:26/71 - (36%) Gaps:18/71 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 LAIPAFINPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPFFHVGFADFWLGDQLNSLA 393
            :|:|..:.|       .:|.||       :..|..|  ....|......||..:|  ||::..::
Yeast    15 IALPTRVEP-------KVFFAN-------ERTFLSW--LNFTVMLGGLGVGLLNF--GDKIGRVS 61

  Fly   394 TAILDF 399
            ..:..|
Yeast    62 AGLFTF 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898
SPX 3..158 CDD:281146
EXS 258..597 CDD:281164 15/71 (21%)
VTC1NP_010995.1 VTC1 1..124 CDD:227589 15/71 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.