DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7536 and VTC1

DIOPT Version :10

Sequence 1:NP_573265.1 Gene:CG7536 / 32786 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_010995.1 Gene:VTC1 / 856803 SGDID:S000000874 Length:129 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:15/71 - (21%)
Similarity:26/71 - (36%) Gaps:18/71 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 LAIPAFINPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPFFHVGFADFWLGDQLNSLA 393
            :|:|..:.|       .:|.||       :..|..|  ....|......||..:|  ||::..::
Yeast    15 IALPTRVEP-------KVFFAN-------ERTFLSW--LNFTVMLGGLGVGLLNF--GDKIGRVS 61

  Fly   394 TAILDF 399
            ..:..|
Yeast    62 AGLFTF 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7536NP_573265.1 SPX_XPR1_like 2..156 CDD:269898
EXS 258..597 CDD:460816 15/71 (21%)
VTC1NP_010995.1 VTC1 1..124 CDD:227589 15/71 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.