DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7536 and VTC4

DIOPT Version :9

Sequence 1:NP_001285398.1 Gene:CG7536 / 32786 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_012522.2 Gene:VTC4 / 853441 SGDID:S000003549 Length:721 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:57/232 - (24%)
Similarity:98/232 - (42%) Gaps:60/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRH---FANFDENFFHYC 62
            |||.||||..:..::...||:|:::|..|             ||::.|.:   ....:.:|....
Yeast     1 MKFGEHLSKSLIRQYSYYYISYDDLKTEL-------------EDNLSKNNGQWTQELETDFLESL 52

  Fly    63 DKELKKINTFYSEKLAEATRKFATLNAELKTSIEESERSAKKSKGHKRHAALPDRKARELKLAFS 127
            :.||.|:.||...|.:|..|:.    .|::..::.:.|             |.|......:|.|.
Yeast    53 EIELDKVYTFCKVKHSEVFRRV----KEVQEQVQHTVR-------------LLDSNNPPTQLDFE 100

  Fly   128 --EFYLSLIL-----LQNYQNLNHTGFRKILKKHDK----------LLRVDTGAKWRQEY----V 171
              |..||.|:     |..:..||:|||:||:|||||          .:|:|:...:::.|    |
Yeast   101 ILEEELSDIIADVHDLAKFSRLNYTGFQKIIKKHDKKTGFILKPVFQVRLDSKPFFKENYDELVV 165

  Fly   172 EASHFFTNKDIDNIINETETTVTGELEGGDRQRAMKR 208
            :.|..:      :|...:...:.|:...|.:|:...|
Yeast   166 KISQLY------DIARTSGRPIKGDSSAGGKQQNFVR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 44/163 (27%)
SPX 3..158 CDD:281146 45/174 (26%)
EXS 258..597 CDD:281164
VTC4NP_012522.2 COG5036 1..497 CDD:227369 57/232 (25%)
DUF202 593..721 CDD:415817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.