DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7536 and SPX4

DIOPT Version :10

Sequence 1:NP_573265.1 Gene:CG7536 / 32786 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001330175.1 Gene:SPX4 / 831385 AraportID:AT5G15330 Length:387 Species:Arabidopsis thaliana


Alignment Length:223 Identity:56/223 - (25%)
Similarity:94/223 - (42%) Gaps:42/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAEHLSAHI---TPEWRKQYINYEEMKAML----YLAVEEAP----------------SVESV 42
            |||.:....|:   .||||.:::.|:.:|.:|    |.:.:..|                ::.|.
plant    70 MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYYSADFGPANSDHNDSRPVFADTTNISSA 134

  Fly    43 EDD--VLK--RHFANFDENFFHYCDKELKKINTFYSEKLAEATRKFATLNAELKTSIEESERSAK 103
            .||  |:.  |...:...:|....:.||:|.|.||.:|    ...|.....|||..||:    .|
plant   135 ADDGGVVPGVRPSEDLQGSFVRILNDELEKFNDFYVDK----EEDFVIRLQELKERIEQ----VK 191

  Fly   104 KSKGHKRHAALPDRKARELKLAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQ 168
            :..|.....:....:..:::......:..::||:||.:||..|..|||||:||    .||...|.
plant   192 EKNGEFASESEFSEEMMDIRRDLVTIHGEMVLLKNYSSLNFAGLVKILKKYDK----RTGGLLRL 252

  Fly   169 EYVEA---SHFFTNKDIDNIINETETTV 193
            .:.:.   ..|||.:.:..::.|.|..:
plant   253 PFTQLVLHQPFFTTEPLTRLVRECEANL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7536NP_573265.1 SPX_XPR1_like 2..156 CDD:269898 45/180 (25%)
EXS 258..597 CDD:460816
SPX4NP_001330175.1 SPX_AtSPX1_like 71..245 CDD:269902 47/185 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.