DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7536 and SPAC1D4.05c

DIOPT Version :9

Sequence 1:NP_001285398.1 Gene:CG7536 / 32786 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_593018.1 Gene:SPAC1D4.05c / 2542527 PomBaseID:SPAC1D4.05c Length:387 Species:Schizosaccharomyces pombe


Alignment Length:418 Identity:95/418 - (22%)
Similarity:153/418 - (36%) Gaps:120/418 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 VTFRLYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFEL--------DPRNHLSEQ--HLMEL-- 308
            |.|.|:....|......|:.|..:.|   .|.:.||:.|        :||..|:.:  ||:::  
pombe     6 VEFPLHHKLALPFRIGLLVIVGTWLW---SVCYHLIYILNRYQPISPNPRGSLNSKWYHLLQIPL 67

  Fly   309 -----------------------------AAIFGVIWTLSMLSFLYSASLAIPAF----INPLTL 340
                                         |||..:.|....:.||......|...    |.||..
pombe    68 SNRHTDLEENTEFKANLVSPVDFHAGYCFAAILSISWATGFILFLKKTQGDIGGLYSHPIYPLLW 132

  Fly   341 TLIMVLFLANPFHVLYHDARFWLWRITGRCVSAP------FFHVGF----ADFWLGDQLNSLATA 395
            .:...:.:..||.        |.:|.:.|.:...      ||...|    .||.:.:...|.|.|
pombe   133 VITAFILIVFPFP--------WRYRSSQRGLRKSIIRVFLFFQADFRSPYKDFIVSEIFTSYAKA 189

  Fly   396 ILDFEYLICFYFTNGNWTEARDASICMEKDFIIRPIVNCLPAWF-----------RFAQCLRRYR 449
            :.||....|  ...|:.::           |.:||.:.|...:|           ...||| .|.
pombe   190 LGDFYIFGC--VLQGHISK-----------FTLRPDLKCDGTFFVPLAMAYPFIVAILQCL-HYG 240

  Fly   450 DSREAFP---HLVNAGKYSTTFMVVIFATLKSFHSPNYASTFDNPYT-WLWIIASIVSSCYAYTW 510
            .||....   :|::|.|::|...|:..:.:.......:..|..:.|. ||||:::::||.|.:.|
pombe   241 LSRRKHTFKINLLSALKHATALPVIYLSAIIHAKQTKFTLTSGHGYLFWLWILSALLSSAYTFLW 305

  Fly   511 DIKMDWGL---FDKNAGENTFLREEVVYSSTGFYYFAILEDLALRFIWAL-------SFYLTEMK 565
            |:.:||.:   |.|:.....|  ...:|:...|..|      .||..|::       .|:..||.
pombe   306 DVFIDWRIRFPFHKSINHKRF--PMFIYAIGCFINF------ILRVTWSMKLHPRLHQFHEYEMG 362

  Fly   566 IVSSDIMTSVTGILEVFRRFVWNFFRLE 593
            |.|.:       :||:.|||:|.||.|:
pombe   363 IFSFE-------MLEILRRFLWLFFHLD 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898
SPX 3..158 CDD:281146
EXS 258..597 CDD:281164 94/416 (23%)
SPAC1D4.05cNP_593018.1 COG5409 2..387 CDD:227696 95/418 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X439
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.