DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7536 and vtc4

DIOPT Version :9

Sequence 1:NP_001285398.1 Gene:CG7536 / 32786 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_588142.1 Gene:vtc4 / 2538788 PomBaseID:SPCC1322.14c Length:721 Species:Schizosaccharomyces pombe


Alignment Length:227 Identity:48/227 - (21%)
Similarity:89/227 - (39%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFANFDENFFHYCDKE 65
            |||.:.|...:..|::..|:||:::|..:....::....|..|.|            |....:||
pombe     1 MKFGQLLKETLMYEYKYSYVNYDKLKKEIKRRNDQGGWSEEDESD------------FVELLEKE 53

  Fly    66 LKKINTFYSEKLAEATRKFATLNAELKTSIEESERSAKKSKGHKRHAALPDRKARELKLAFSEFY 130
            |.|:.:|...|.||...:       ::...|:::...::...        |....|...|..|..
pombe    54 LDKVYSFQKNKSAEVMER-------IRFCEEQTDEVVRRLDS--------DNPPNENDFAILETE 103

  Fly   131 LSLIL-----LQNYQNLNHTGFRKILKKHDK----------LLRVDTGAKWRQEY----VEASHF 176
            |:.|:     |..:..||:|.|.||:|||||          ..|::....::::|    |:.|..
pombe   104 LTDIMATVHDLAKFSELNYTAFYKIIKKHDKHTGWILKPVFAARLNAKPFFKEQYDLLVVKLSKL 168

  Fly   177 FTNKDIDNIINETETTVTGELEGGDRQRAMKR 208
            :      :.:....:.:.|:...|..|:...|
pombe   169 Y------DFVRTRGSPIKGDSAAGGTQQNFVR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 37/158 (23%)
SPX 3..158 CDD:281146 38/169 (22%)
EXS 258..597 CDD:281164
vtc4NP_588142.1 COG5036 1..504 CDD:227369 48/227 (21%)
SPX_VTC2_like 2..134 CDD:269901 37/158 (23%)
PolyPPase_VTC4_like 188..473 CDD:143623 2/7 (29%)
VTC1 609..721 CDD:227589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.