DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and Olfm1

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_446025.1 Gene:Olfm1 / 93667 RGDID:620320 Length:485 Species:Rattus norvegicus


Alignment Length:297 Identity:84/297 - (28%)
Similarity:141/297 - (47%) Gaps:38/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   667 SILNNFEIQATGNLSY-------PGLPKRPKTCY-------LYAVGKPVFHKVVNEKFGSWLRDP 717
            |:||..: :..|...|       ..|.:|.:.|.       |..:..||..|....:||||:.||
  Rat   190 SVLNELQ-EEIGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVTVKTSGSRFGSWMTDP 253

  Fly   718 -SPDSDREKTFVTNENDPYNLFEFTTRIQYRMNSIPRRKYEIQEGFHGNAHVVFNGSFYYQQRNS 781
             :|:.|....::...::...:.|:.:.:.: ||:.....:.:...:.|...||:|||.|:.:..|
  Rat   254 LAPEGDNRVWYMDGYHNNRFVREYKSMVDF-MNTDNFTSHRLPHPWSGTGQVVYNGSIYFNKFQS 317

  Fly   782 DLVVKLDL---TSLKKITTQLPYAGVAAANRLYTTDYNY-------MDFNVDEVGLWVIYST-YN 835
            .::::.||   |.||  |..|.|||       |...|:|       :|..|||.|||.:|:| .|
  Rat   318 HIIIRFDLKTETILK--TRSLDYAG-------YNNMYHYAWGGHSDIDLMVDENGLWAVYATNQN 373

  Fly   836 SNNTLVAKLDAETLKMQYNFNITLDHHQFGEMFIVCGNLYAIDSGTDKNTQIRYVVDLYKGKLLN 900
            :.|.:::|||..:|::...:|.:......||.||:||.|| :.:|....|::.|...........
  Rat   374 AGNIVISKLDPVSLQILQTWNTSYPKRSAGEAFIICGTLY-VTNGYSGGTKVHYAYQTNASTYEY 437

  Fly   901 TNLPFSNPFSHTTTVGYNPLTVELYSWDKGNALTYPI 937
            .::||.|.:||.:.:.|||....||:|:.|:...|.:
  Rat   438 IDIPFQNKYSHISMLDYNPKDRALYAWNNGHQTLYNV 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 76/254 (30%)
Olfm1NP_446025.1 Noelin-1 56..152 CDD:403504
PRK03918 <92..>218 CDD:235175 6/28 (21%)
OLF 228..478 CDD:128580 76/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5230
eggNOG 1 0.900 - - E1_KOG3545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X205
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.