DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and opcml

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001072487.1 Gene:opcml / 779942 XenbaseID:XB-GENE-5831850 Length:346 Species:Xenopus tropicalis


Alignment Length:192 Identity:56/192 - (29%)
Similarity:77/192 - (40%) Gaps:29/192 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 QVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLRFTNITRHQ 501
            |:.:....:.|.||.::.|.|.|||.|.|.|.||...|::      .......::|..|.|||.|
 Frog   139 QILNISSDITVNEGSTVALRCLATGRPEPAVTWRHFTGKS------HRFVSDDEYLEITGITRDQ 197

  Fly   502 MAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAIRYWER-- 564
            ...|.|.|.|.::........|.|.:.|.||..|. ..|.......|.|...|.|.|...|.|  
 Frog   198 SGQYECSAANDVSAPDIRKVRVTVNYPPYISDTRN-TGASLGQKGILRCSASAVPLAEFQWYREE 261

  Fly   565 -----AYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMV 618
                 ..||..::..|...|            ||..|:.:.|:|.|.|||.|:|   ||:::
 Frog   262 TRLANGLDGVRIENKDHMSI------------LTFFNVSEKDYGNYTCVASNKLGNSNASVI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 25/82 (30%)
IGc2 449..511 CDD:197706 22/61 (36%)
IG_like 544..612 CDD:214653 20/74 (27%)
Ig 546..612 CDD:143165 20/72 (28%)
OLF 694..937 CDD:280371
opcmlNP_001072487.1 Ig 46..134 CDD:325142
Ig_3 138..207 CDD:316449 24/73 (33%)
ig 228..312 CDD:278476 27/97 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.