DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:282 Identity:86/282 - (30%)
Similarity:138/282 - (48%) Gaps:38/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 LLIPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVN-GVEMASISGQ 490
            :::||:|.|...   ...:||.||.::.|.|.|.|:|.|.::|:|:||..|.:| .:|:..:...
  Fly   153 VVVPPNIDDALT---SSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETD 214

  Fly   491 FLRFTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAF 555
            .|....|:|..|.||.|.|:||:.|..:....|.|.|:||:.:..|::......:.||||.:||.
  Fly   215 SLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEAN 279

  Fly   556 PEAIRYWERAYDGKILDPSDKYGIESYP--EGFKTTMRLTISNLRKDDFGYYHCVARNELNATMV 618
            |.::.||.|..| :::..|.||..|:.|  ..:|.||||||:|::..|:|.|.|||:|       
  Fly   280 PTSLNYWTREND-QMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKN------- 336

  Fly   619 NFEIAPQDPNSETPYVGNNMKVYGQRPPESECPVCDQCPDPSLYQCKDSILNNFEIQATGNLSYP 683
                    |..:   :..|:|:|...||.::       |.|:....:.:.....||...|.::.|
  Fly   337 --------PRGD---MDGNIKLYMSSPPTTQ-------PPPTTTTLRRTTTTAAEIALDGYINTP 383

  Fly   684 ------GLPKRPKTCYLYAVGK 699
                  |:.....|..:.|.||
  Fly   384 LNGNGIGIVGEGPTNSVIASGK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 29/83 (35%)
IGc2 449..511 CDD:197706 23/62 (37%)
IG_like 544..612 CDD:214653 30/69 (43%)
Ig 546..612 CDD:143165 30/67 (45%)
OLF 694..937 CDD:280371 3/6 (50%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 0/1 (0%)
Ig 69..139 CDD:143165
IG_like 165..249 CDD:214653 29/83 (35%)
IGc2 172..237 CDD:197706 24/64 (38%)
IG_like 267..348 CDD:214653 34/99 (34%)
Ig 270..339 CDD:299845 32/84 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11661
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.