Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021334871.1 | Gene: | ntm / 678534 | ZFINID: | ZDB-GENE-060421-6020 | Length: | 380 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 66/206 - (32%) |
---|---|---|---|
Similarity: | 95/206 - (46%) | Gaps: | 23/206 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLR 493
Fly 494 FTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEA 558
Fly 559 IRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMVNF 620
Fly 621 EIAPQDPNSET 631 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 24/82 (29%) | ||
IGc2 | 449..511 | CDD:197706 | 17/61 (28%) | ||
IG_like | 544..612 | CDD:214653 | 25/67 (37%) | ||
Ig | 546..612 | CDD:143165 | 25/65 (38%) | ||
OLF | 694..937 | CDD:280371 | |||
ntm | XP_021334871.1 | Ig | 44..132 | CDD:325142 | |
Ig_3 | 135..205 | CDD:316449 | 22/80 (28%) | ||
I-set | 228..309 | CDD:333254 | 29/86 (34%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm26286 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |