DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and ntm

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_021334871.1 Gene:ntm / 678534 ZFINID:ZDB-GENE-060421-6020 Length:380 Species:Danio rerio


Alignment Length:206 Identity:66/206 - (32%)
Similarity:95/206 - (46%) Gaps:23/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLR 493
            :||.|.::     .|.::|.||.::.|.|.|.|.|.|.:.||.:....      :..|...:.|.
Zfish   134 VPPKIVNL-----SRDLVVNEGSNVTLMCLANGKPEPAIVWRMKSPSD------DSLSSDSEVLD 187

  Fly   494 FTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEA 558
            ...|:|::...|.|.|.|.|| |...|..:.|.:||.:|..|. :.........|:|..:|.|||
Zfish   188 IPFISRYRAGVYECTAANDIA-VDTQTVELTVNYAPSVSDGRD-VGVTLGQRGVLQCEADAVPEA 250

  Fly   559 IRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMVNF 620
            ...|.|. |.:|.:..|  |||....|  ...|||..|:.:.|:|.|.|||.|:|   |.:.|.:
Zfish   251 DFEWYRD-DRRIFNGLD--GIEIEAAG--ALSRLTFFNVSEADYGNYTCVAINKLGSANTSFVLY 310

  Fly   621 EIAPQDPNSET 631
            ||.  :|.|.|
Zfish   311 EII--EPTSST 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 24/82 (29%)
IGc2 449..511 CDD:197706 17/61 (28%)
IG_like 544..612 CDD:214653 25/67 (37%)
Ig 546..612 CDD:143165 25/65 (38%)
OLF 694..937 CDD:280371
ntmXP_021334871.1 Ig 44..132 CDD:325142
Ig_3 135..205 CDD:316449 22/80 (28%)
I-set 228..309 CDD:333254 29/86 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.