DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and lsamp

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001034921.1 Gene:lsamp / 664692 ZFINID:ZDB-GENE-090108-1 Length:333 Species:Danio rerio


Alignment Length:243 Identity:65/243 - (26%)
Similarity:102/243 - (41%) Gaps:47/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 IQVP----DFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLRFTN 496
            :|||    .....:.|.||.::.|:|.|.|.|.|.:.||.       :|....|...|::|..:.
Zfish   124 VQVPAIIYKVSEDITVNEGSNVALTCLANGRPDPAITWRL-------LNPSAEALDVGEYLEISG 181

  Fly   497 ITRHQMAAYTCFANNGIAPVANATYL-VEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAIR 560
            :.|.|...|.|.|:|.:: ..:..|: |.|.:.|.|...|....|..| :..|.|...|.|:...
Zfish   182 VVRSQAGRYECKASNDVS-TPDVKYVNVVVNYPPYIKDVRSSETAVGQ-AGVLHCEASAVPQPEF 244

  Fly   561 YWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMVNFEI 622
            .|.|  |.:.|..|....|:  ..|.:|.  |.::|:.::|:|.|.|||.|.|   ||::..:: 
Zfish   245 EWYR--DERRLSSSQSLTIQ--VSGSRTV--LVVANVTEEDYGNYTCVATNRLGVHNASVFLYK- 302

  Fly   623 APQDPNSETPYVGNNMKVYGQRPPESECPVCDQ------CPDPSLYQC 664
                     |.:|.::...|       | :|..      |...:|.||
Zfish   303 ---------PGMGRDINSAG-------C-ICQSLWLLLLCVSSALLQC 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 23/83 (28%)
IGc2 449..511 CDD:197706 19/61 (31%)
IG_like 544..612 CDD:214653 20/67 (30%)
Ig 546..612 CDD:143165 20/65 (31%)
OLF 694..937 CDD:280371
lsampNP_001034921.1 Ig 34..124 CDD:299845 65/243 (27%)
IG_like 36..124 CDD:214653 65/243 (27%)
IG_like 134..197 CDD:214653 20/69 (29%)
IGc2 141..199 CDD:197706 20/64 (31%)
I-set 213..300 CDD:254352 29/93 (31%)
Ig 231..298 CDD:143165 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.