Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 213 | Identity: | 72/213 - (33%) |
---|---|---|---|
Similarity: | 120/213 - (56%) | Gaps: | 11/213 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 427 LLIPPSITDIQ-VPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASI-SG 489
Fly 490 QFLRFTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEA 554
Fly 555 FPEAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNATMVN 619
Fly 620 FEI----APQDPNSETPY 633 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 28/83 (34%) | ||
IGc2 | 449..511 | CDD:197706 | 23/62 (37%) | ||
IG_like | 544..612 | CDD:214653 | 25/67 (37%) | ||
Ig | 546..612 | CDD:143165 | 25/65 (38%) | ||
OLF | 694..937 | CDD:280371 | |||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 0/1 (0%) |
Ig | 145..238 | CDD:416386 | 33/95 (35%) | ||
Ig strand A | 145..149 | CDD:409353 | 2/3 (67%) | ||
Ig strand A' | 154..159 | CDD:409353 | 2/7 (29%) | ||
Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 185..187 | CDD:409353 | 1/1 (100%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 0/7 (0%) | ||
Ig | 242..333 | CDD:416386 | 34/92 (37%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 272..277 | CDD:409353 | 3/6 (50%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 295..305 | CDD:409353 | 2/9 (22%) | ||
Ig strand F | 314..322 | CDD:409353 | 3/7 (43%) | ||
Ig strand G | 325..334 | CDD:409353 | 1/8 (13%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 50 | 1.000 | Domainoid score | I11661 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm26286 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |