DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and OLFML3

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_064575.1 Gene:OLFML3 / 56944 HGNCID:24956 Length:406 Species:Homo sapiens


Alignment Length:304 Identity:73/304 - (24%)
Similarity:130/304 - (42%) Gaps:43/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   672 FEIQATGNLSYPGLPKRPK-----TCYLYAVGKPVFHKVVNEKFGS----WLRDPSPDSDREKTF 727
            |:.:.||.....|..:|.:     |...|.:.:....|:: ::||.    |.:||.  ...||.:
Human   109 FDEKVTGGPGTKGKGRRNEKYDMVTDCGYTISQVRSMKIL-KRFGGPAGLWTKDPL--GQTEKIY 170

  Fly   728 VTN--ENDPYNLF----EFTTRIQYRMNSIPRRKYEIQEGFHGNAHVVFNGSFYYQQR------- 779
            |.:  :||...:|    :||..:..|..|    :..:...:.|...:|:.|..|:.:|       
Human   171 VLDGTQNDTAFVFPRLRDFTLAMAARKAS----RVRVPFPWVGTGQLVYGGFLYFARRPPGRPGG 231

  Fly   780 -----NSDLVVKLDLTSLKKITTQL-PYAGVAAANRLYTTDYNYMDFNVDEVGLWVIYSTYNSNN 838
                 |:..::|..|.:...:.:.: |..|:.....| |.| .|:|...||.|||.:|:|...:.
Human   232 GGEMENTLQLIKFHLANRTVVDSSVFPAEGLIPPYGL-TAD-TYIDLAADEEGLWAVYATREDDR 294

  Fly   839 TL-VAKLDAETLKMQYNFNITLDHHQFGEMFIVCGNLYAI-DSGTDKNTQIRYVVDLYKGKLL-- 899
            .| :||||.:||..:..::...........|::||.||.: ::......:|:...|. .|.|.  
Human   295 HLCLAKLDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQCSFDA-SGTLTPE 358

  Fly   900 NTNLP-FSNPFSHTTTVGYNPLTVELYSWDKGNALTYPIRYNEQ 942
            ...|| |...:....::.|||...:||:||.|..:.|.:...::
Human   359 RAALPYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMRKK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 67/270 (25%)
OLFML3NP_064575.1 PspA_IM30 <25..100 CDD:332836
OLF 139..397 CDD:308029 66/267 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.