DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and olfml3b

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001070719.1 Gene:olfml3b / 562022 ZFINID:ZDB-GENE-050302-161 Length:390 Species:Danio rerio


Alignment Length:248 Identity:61/248 - (24%)
Similarity:116/248 - (46%) Gaps:28/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 GSWLRDPSPDSDREKTFVTNENDPYNLFEFTTRIQYRMNSIPRRKYEIQ--EGFHGNAHVVFNGS 773
            |.|.:|..  |...|.::.|..|...:|||.|..::..:........||  ..:.|..|.::|..
Zfish   152 GMWTKDMG--SATGKVYILNGTDDNTVFEFGTVREFTSSQGTSGATTIQLPSAWRGMGHAIYNNH 214

  Fly   774 FYYQQRNSDL-VVKLDL-------TSLKKITTQLPYAGVAAANRLYTTD-YNYMDFNVDEVGLWV 829
            .||.::..:: ::|.||       :::..:..|||         :|:.: ..::|..|||.|||.
Zfish   215 MYYLKQGEEMKLIKFDLQKNIIVDSAVFPVKNQLP---------VYSLNPETFIDLAVDEEGLWA 270

  Fly   830 IYSTY-NSNNTLVAKLDAETLKMQYNFNITLDHHQFGEMFIVCGNLYAI-DSGTDKNTQIRYVVD 892
            ||:|. |..:..:||:|.:||.:|..::...........|::||.:|.: :|.....::|:.|.|
Zfish   271 IYATQENERHISLAKIDPKTLDIQQMWDTPCVRENAEAAFVICGTVYVVYNSKLPSRSRIQCVFD 335

  Fly   893 LYKGKLLNTNLP---FSNPFSHTTTVGYNPLTVELYSWDKGNALTYPIRYNEQ 942
            : ...:.|...|   |...:...:::.|:|:...||:||.|..:.|.::..::
Zfish   336 V-SDMVNNDEAPHVYFPKRYGTHSSLKYSPVEQLLYAWDDGYQILYKLQLKKK 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 61/241 (25%)
olfml3bNP_001070719.1 cyano_w_EgtBD <18..107 CDD:275168
OLF 135..378 CDD:280371 60/237 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.