Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017775.2 | Gene: | iglon5 / 550472 | ZFINID: | ZDB-GENE-050417-297 | Length: | 332 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 61/196 - (31%) |
---|---|---|---|
Similarity: | 85/196 - (43%) | Gaps: | 30/196 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 436 IQVP----DFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLRFTN 496
Fly 497 ITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAIRY 561
Fly 562 WERAYDGKILDPSDKYGIES----YPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMVN 619
Fly 620 F 620 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 27/82 (33%) | ||
IGc2 | 449..511 | CDD:197706 | 20/61 (33%) | ||
IG_like | 544..612 | CDD:214653 | 20/71 (28%) | ||
Ig | 546..612 | CDD:143165 | 20/69 (29%) | ||
OLF | 694..937 | CDD:280371 | |||
iglon5 | NP_001017775.2 | IG_like | 33..123 | CDD:214653 | 61/196 (31%) |
Ig | 35..123 | CDD:299845 | 61/196 (31%) | ||
Ig | 125..>183 | CDD:299845 | 20/66 (30%) | ||
I-set | 128..207 | CDD:254352 | 27/87 (31%) | ||
IG_like | 217..298 | CDD:214653 | 27/90 (30%) | ||
ig | 223..296 | CDD:278476 | 24/81 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm26286 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |