DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and iglon5

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:196 Identity:61/196 - (31%)
Similarity:85/196 - (43%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 IQVP----DFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLRFTN 496
            :|||    :..:...|.||..:||.|.|.|.|.|.:.|:......:|         .|:||..|.
Zfish   123 VQVPARIVNISQDKSVNEGEDVNLFCLAVGRPEPTITWKDFKYGLLN---------EGEFLEITE 178

  Fly   497 ITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAIRY 561
            |.|||...:.|..|||:||.......|.|.:.|:|:..:.| .|:...:|.|.|...|.|.|...
Zfish   179 IKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVKNM-PAQVGKTAILRCEAMAVPTASFE 242

  Fly   562 WERAYDGKILDPSDKYGIES----YPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMVN 619
            |.|         .|:..:||    ..:..||...|..:|:.:..||.|.|.|.|.|   ||:|:.
Zfish   243 WYR---------DDRRPVESDNTLKIKNEKTRSLLLFTNVTEKHFGNYTCFASNRLGASNASMLL 298

  Fly   620 F 620
            |
Zfish   299 F 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 27/82 (33%)
IGc2 449..511 CDD:197706 20/61 (33%)
IG_like 544..612 CDD:214653 20/71 (28%)
Ig 546..612 CDD:143165 20/69 (29%)
OLF 694..937 CDD:280371
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 61/196 (31%)
Ig 35..123 CDD:299845 61/196 (31%)
Ig 125..>183 CDD:299845 20/66 (30%)
I-set 128..207 CDD:254352 27/87 (31%)
IG_like 217..298 CDD:214653 27/90 (30%)
ig 223..296 CDD:278476 24/81 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.