DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and Ntm

DIOPT Version :10

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:206 Identity:63/206 - (30%)
Similarity:95/206 - (46%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLR 493
            :.|.|.:|     ...:.:.||.:::|:|.|||.|.|.|.||.     |:...|...| ..::|.
  Rat   134 VSPKIVEI-----SSDISINEGNNISLTCIATGRPEPTVTWRH-----ISPKAVGFVS-EDEYLE 187

  Fly   494 FTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEA 558
            ...|||.|...|.|.|:|.:|........|.|.:.|.||..:.......| ..||:|...|.|.|
  Rat   188 IQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQ-KGTLQCEASAVPSA 251

  Fly   559 IRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMVNF 620
            ...|.:. |.::::......:|:.|    ...|||..|:.:.|:|.|.|||.|:|   ||:::.|
  Rat   252 EFQWFKD-DKRLVEGKKGVKVENRP----FLSRLTFFNVSEHDYGNYTCVASNKLGHTNASIMLF 311

  Fly   621 EIAPQDPNSET 631
            |:  .:|.|.|
  Rat   312 EL--NEPTSST 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 gly_rich_SclB <257..>409 CDD:468478
Ig 436..525 CDD:472250 27/88 (31%)
Ig strand B 453..457 CDD:409353 1/3 (33%)
Ig strand C 466..470 CDD:409353 1/3 (33%)
Ig strand E 490..494 CDD:409353 1/3 (33%)
Ig strand F 504..509 CDD:409353 2/4 (50%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Ig_3 529..611 CDD:464046 24/81 (30%)
OLF 694..939 CDD:460482
NtmNP_001418383.1 Ig 44..132 CDD:472250
Ig strand B 53..57 CDD:409382
Ig strand C 65..69 CDD:409382
Ig strand E 98..102 CDD:409382
Ig strand F 112..117 CDD:409382
Ig strand G 125..128 CDD:409382
Ig_3 136..205 CDD:464046 26/79 (33%)
Ig 223..307 CDD:472250 27/89 (30%)
Ig strand B 239..243 CDD:409408 2/3 (67%)
Ig strand C 252..256 CDD:409408 0/3 (0%)
Ig strand E 278..282 CDD:409408 2/3 (67%)
Ig strand F 292..297 CDD:409408 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.