DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and negr1

DIOPT Version :10

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:225 Identity:64/225 - (28%)
Similarity:93/225 - (41%) Gaps:38/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLR 493
            :||.|.||     ...:.|.||.:::|.|.|:|.|.|::.||       :::.......||::|.
Zfish   138 VPPKIYDI-----SSDITVNEGSNVSLICAASGKPEPKISWR-------HISPSARKYESGEYLN 190

  Fly   494 FTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSS-------ATLECL 551
            .|.|:|.|...|.|.|.|.||.....|..|.|.|.|.|.        |.:|.       |.|.|.
Zfish   191 ITGISRDQAGDYECGAENDIASPDTKTVRVTVNFPPAIH--------EMKSHGVRPGQVALLRCE 247

  Fly   552 VEAFPEAIRYWERAYDG-KILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNA 615
            ..|.|..:..|   |.| |.::......|.:    ..:...||:.|:.:|.:|.|.|||.|.|..
Zfish   248 AAAVPSPVFEW---YKGEKRINMGQGIVINN----LSSRSVLTVKNMTQDRYGNYTCVAVNRLGT 305

  Fly   616 TMVNFEIAPQDPNSETPYV---GNNMKVYG 642
            ...:..:.|....:.|..|   .:|..:||
Zfish   306 ANASVPLNPIIEPTTTSAVSSPASNPAMYG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 gly_rich_SclB <257..>409 CDD:468478
Ig 436..525 CDD:472250 27/88 (31%)
Ig strand B 453..457 CDD:409353 1/3 (33%)
Ig strand C 466..470 CDD:409353 0/3 (0%)
Ig strand E 490..494 CDD:409353 1/3 (33%)
Ig strand F 504..509 CDD:409353 2/4 (50%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Ig_3 529..611 CDD:464046 23/89 (26%)
OLF 694..939 CDD:460482
negr1XP_009300786.1 Ig 42..121 CDD:472250
Ig strand B 55..59 CDD:409353
Ig strand C 67..71 CDD:409353
Ig strand E 102..106 CDD:409353
Ig strand F 116..121 CDD:409353
Ig 140..222 CDD:472250 30/93 (32%)
Ig strand B 157..161 CDD:409256 1/3 (33%)
Ig strand C 170..174 CDD:409256 0/3 (0%)
Ig strand E 187..191 CDD:409256 1/3 (33%)
Ig strand F 201..206 CDD:409256 2/4 (50%)
Ig strand G 215..218 CDD:409256 0/2 (0%)
Ig 236..312 CDD:472250 21/82 (26%)
Ig strand B 242..246 CDD:409353 2/3 (67%)
Ig strand C 255..259 CDD:409353 1/6 (17%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.