DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and olfm2b

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_998425.2 Gene:olfm2b / 406544 ZFINID:ZDB-GENE-040426-2402 Length:490 Species:Danio rerio


Alignment Length:263 Identity:68/263 - (25%)
Similarity:121/263 - (46%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 LYAVGKPVFHKVVNEKFGSWLRDPSPDSDREKTFVTNENDPY----------NLFEFTTRIQYRM 748
            |.::..|:..:....:||||:.:.|.:|...:.:|.   |.|          :|.:|.:...|.:
Zfish   224 LISISAPLTVRSSGSRFGSWMMETSIESSDNRVWVM---DGYLKGRRVLEYPSLQDFASGQNYIV 285

  Fly   749 NSIPRRKYEIQEGFHGNAHVVFNGSFYYQQRNSDLVVKLDLTSLKKI-TTQLPYAGVAAANRLYT 812
            :.:|       ..:.|..|||||||.||.:..|.::|:..|.|...: ..:||.||       :.
Zfish   286 HHLP-------HAWAGTGHVVFNGSLYYSKHQSSVLVRYGLASGSVLQQRELPDAG-------FN 336

  Fly   813 TDYNY-------MDFNVDEVGLWVIYSTYNSNNT-LVAKLDAETLKMQYNFNITLDHHQFGEMFI 869
            ..:.|       :|..||..|||.::|:.....| |:::|...:|::..:::........||.|:
Zfish   337 NTFPYSWGGASDIDLMVDGSGLWAVHSSAGRGGTLLLSRLHPLSLQVLRSWDTGFPKRSAGEAFL 401

  Fly   870 VCGNLYAIDSGTDKNTQIRYVVDLYKGKLLNTNLPFSNPFSHTTTVGYNPLTVELYSWDKGNALT 934
            :||.||..||.. ...::.:....:......|::.|.|.:||.:.:.|||.|..||:|:.|..:.
Zfish   402 ICGTLYITDSHL-PGAKVAFRFHTHTHTYQYTDIAFHNQYSHISMLDYNPRTRALYTWNNGQQVL 465

  Fly   935 YPI 937
            |.:
Zfish   466 YQL 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 68/261 (26%)
olfm2bNP_998425.2 Noelin-1 51..146 CDD:289107
MscS_porin <82..214 CDD:289559
OLF 224..468 CDD:280371 68/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5398
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_112827
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X205
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.