| Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001094842.1 | Gene: | IGLON5 / 402665 | HGNCID: | 34550 | Length: | 336 | Species: | Homo sapiens |
| Alignment Length: | 211 | Identity: | 62/211 - (29%) |
|---|---|---|---|
| Similarity: | 89/211 - (42%) | Gaps: | 33/211 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRR-EDGRTINVNGVEMASISGQFL 492
Fly 493 RFTNITRHQMAAYTCFANNGI--APVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAF 555
Fly 556 PEAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNATMVNF 620
Fly 621 EI---------APQDP 627 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
| IG_like | 442..525 | CDD:214653 | 30/85 (35%) | ||
| IGc2 | 449..511 | CDD:197706 | 22/62 (35%) | ||
| IG_like | 544..612 | CDD:214653 | 18/67 (27%) | ||
| Ig | 546..612 | CDD:143165 | 18/65 (28%) | ||
| OLF | 694..937 | CDD:280371 | |||
| IGLON5 | NP_001094842.1 | Ig | 41..129 | CDD:416386 | |
| Ig strand A' | 41..46 | CDD:409353 | |||
| Ig strand B | 48..56 | CDD:409353 | |||
| CDR1 | 56..60 | CDD:409353 | |||
| FR2 | 61..68 | CDD:409353 | |||
| Ig strand C | 61..67 | CDD:409353 | |||
| CDR2 | 69..79 | CDD:409353 | |||
| Ig strand C' | 71..74 | CDD:409353 | |||
| Ig strand C' | 76..79 | CDD:409353 | |||
| FR3 | 80..115 | CDD:409353 | |||
| Ig strand D | 84..91 | CDD:409353 | |||
| Ig strand E | 94..100 | CDD:409353 | |||
| Ig strand F | 107..115 | CDD:409353 | |||
| CDR3 | 116..120 | CDD:409353 | |||
| Ig strand G | 120..129 | CDD:409353 | |||
| FR4 | 122..129 | CDD:409353 | |||
| Ig_3 | 134..199 | CDD:404760 | 27/79 (34%) | ||
| Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
| Ig strand C | 162..170 | CDD:409353 | 4/7 (57%) | ||
| Ig strand F | 191..199 | CDD:409353 | 2/7 (29%) | ||
| Ig strand G | 202..212 | CDD:409353 | 2/10 (20%) | ||
| Ig_3 | 217..295 | CDD:404760 | 21/82 (26%) | ||
| putative Ig strand A | 218..224 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 234..238 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 57 | 1.000 | Domainoid score | I10858 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||