| Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
| Alignment Length: | 207 | Identity: | 66/207 - (31%) |
|---|---|---|---|
| Similarity: | 95/207 - (45%) | Gaps: | 22/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 430 PPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLRF 494
Fly 495 TNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAI 559
Fly 560 RYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLR-----KDDFGYYHCVARN---ELNAT 616
Fly 617 MVNFE-IAPQDP 627 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
| IG_like | 442..525 | CDD:214653 | 23/82 (28%) | ||
| IGc2 | 449..511 | CDD:197706 | 19/61 (31%) | ||
| IG_like | 544..612 | CDD:214653 | 23/75 (31%) | ||
| Ig | 546..612 | CDD:143165 | 23/73 (32%) | ||
| OLF | 694..937 | CDD:280371 | |||
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | |
| FR1 | 37..50 | CDD:409353 | |||
| Ig strand A' | 37..42 | CDD:409353 | |||
| Ig strand B | 44..51 | CDD:409353 | |||
| CDR1 | 51..59 | CDD:409353 | |||
| Ig strand C | 59..63 | CDD:409353 | |||
| FR2 | 60..63 | CDD:409353 | |||
| CDR2 | 67..81 | CDD:409353 | |||
| Ig strand C' | 68..72 | CDD:409353 | |||
| Ig strand C' | 79..81 | CDD:409353 | |||
| FR3 | 84..115 | CDD:409353 | |||
| Ig strand D | 84..90 | CDD:409353 | |||
| Ig strand E | 94..102 | CDD:409353 | |||
| Ig strand F | 108..115 | CDD:409353 | |||
| CDR3 | 116..124 | CDD:409353 | |||
| FR4 | 124..130 | CDD:409353 | |||
| Ig strand G | 124..130 | CDD:409353 | |||
| Ig_3 | 134..208 | CDD:404760 | 24/80 (30%) | ||
| Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 29/96 (30%) | ||
| Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.920 | |||||