DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and Olfml1

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001013210.1 Gene:Olfml1 / 361621 RGDID:1311854 Length:402 Species:Rattus norvegicus


Alignment Length:432 Identity:98/432 - (22%)
Similarity:176/432 - (40%) Gaps:68/432 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 MIYAEYQSSATLECLVEAF---------PEAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRL 592
            |:.|...:||:|...:.||         |..:.|..:.:  ::|:    .|:|...:    |.|.
  Rat     1 MMVALPGASASLVLFLAAFLPPLQHAQDPAMVHYIYQRF--QVLE----QGLEKCAQ----TTRA 55

  Fly   593 TISNLRKDDFGYYHCVAR-----NELNATMVNFEIAPQDPNSETPYVGNNMKVYGQRPPESECPV 652
            .|.:.::........:.|     ||..:.:.|..:..:....|..|:        |...||    
  Rat    56 YIQDFQEFSKNLSTMLGRCQTHTNEYRSAVDNLALRVERAQREIDYL--------QYLRES---- 108

  Fly   653 CDQCPDPSLYQCKDSILNNFE----IQATGNLSYPGLPKRPKTCYLYAVGKPVFHKVVNEKFGSW 713
             |.|.:.......:.:|...|    |:...|.|...:        |.|:......|...:..|||
  Rat   109 -DFCVESEEKTSAEKVLQEAEEEKKIRTLLNTSCDNM--------LMAIKSLKIVKKTVDPEGSW 164

  Fly   714 LRDPSPDSDREKTFVTNENDPYNLFEFTTRIQYRMNSIP--RRKYEIQEGFHGNAHVVFNG-SFY 775
            ::|....|.:......:.|:  .::||.....:..:|:.  .||..:...:.|:..||:.. .|:
  Rat   165 MKDAGSTSAKVYLLAGSRNN--TVWEFANLRAFMEDSVKPGPRKLTLPLSWQGSGQVVYQSFLFF 227

  Fly   776 YQQRNSDLVVKLDLTSLKKITTQLPYAGVAAANRLYTTDYN-YMDFNVDEVGLWVIYSTYNSNNT 839
            :.|..|:.::|.:|.. |.:..::...|.|....:|....: |:|..|||.|||.|:|.......
  Rat   228 HNQGTSNEIIKYNLQK-KTVEDRMLLPGGAGRAPIYQHSLSTYIDLAVDEHGLWAIHSGPGIQGH 291

  Fly   840 LV-AKLDAETLKMQYNFNITLDHHQFGEMFIVCGNLYAI-DSGTDKNTQIRYVVDLYKGKLLNTN 902
            || .|::|.||.::::::...........|::||.||.: .||.....:|..|.|.. |.:...:
  Rat   292 LVLTKIEAGTLGIEHSWDTPCRSQDAEASFLLCGVLYVVYSSGGQGPHRITCVYDPL-GTVREEH 355

  Fly   903 LPFSNPF------SHTTTVGYNPLTVELYSWDKGNALTYPIR 938
            ||  |.|      || :.:.|||...:||:|::|..:.|.::
  Rat   356 LP--NLFFPRRARSH-SMIHYNPRDKQLYAWNEGYQIIYKLQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653 14/81 (17%)
Ig 546..612 CDD:143165 13/79 (16%)
OLF 694..937 CDD:280371 67/254 (26%)
Olfml1NP_001013210.1 OLF 145..393 CDD:396664 67/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.