DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and olfm2a

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_005163803.1 Gene:olfm2a / 334035 ZFINID:ZDB-GENE-040426-2882 Length:483 Species:Danio rerio


Alignment Length:256 Identity:71/256 - (27%)
Similarity:124/256 - (48%) Gaps:23/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 LYAVGKPVFHKVVNEKFGSWLRDPS-PDSDREKTFVTNENDPYNLFEFTTRIQYR-MNSIPRRKY 756
            |..|..|:..:....:||||:.|.. |.||.....:    |.|  |:....::|| ||...:.:.
Zfish   228 LTGVSNPITVRASGSRFGSWMTDTMIPSSDNRVWSM----DGY--FKGRRVLEYRTMNDFMKGQN 286

  Fly   757 EIQ----EGFHGNAHVVFNGSFYYQQRNSDLVVKLDLTSLKKITTQLPYAGVAAANRLYTTDYNY 817
            .:|    ..:.|..|||:|||.||.:..|::::|....| :.:..|...:|....|   |..|::
Zfish   287 FVQHLLPHPWAGTGHVVYNGSLYYNKYQSNILIKYHFRS-RSVLVQRSLSGAGYNN---TFPYSW 347

  Fly   818 -----MDFNVDEVGLWVIYSTY-NSNNTLVAKLDAETLKMQYNFNITLDHHQFGEMFIVCGNLYA 876
                 :|...||.|||.:|:|. |:.|.::::|:.::|::...::........||.|::||.||.
Zfish   348 GGSSDIDLMADENGLWAVYTTIPNAGNIVISRLEPQSLEVLQTWDTGFPKRSAGESFMICGTLYV 412

  Fly   877 IDSGTDKNTQIRYVVDLYKGKLLNTNLPFSNPFSHTTTVGYNPLTVELYSWDKGNALTYPI 937
            .:|.. ...:|.:...........|::||.|.:||.:.:.|||....||:|:.|:.:.|.:
Zfish   413 TNSHL-AGAKIYFAYYTNTSTYEYTDIPFHNQYSHISMMDYNPRERVLYTWNNGHQVLYNV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 71/254 (28%)
olfm2aXP_005163803.1 Noelin-1 52..150 CDD:289107
OLF 228..472 CDD:280371 71/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5398
eggNOG 1 0.900 - - E1_KOG3545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X205
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.