Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006510497.1 | Gene: | Opcml / 330908 | MGIID: | 97397 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 60/199 - (30%) |
---|---|---|---|
Similarity: | 90/199 - (45%) | Gaps: | 19/199 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLR 493
Fly 494 FTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEA 558
Fly 559 IRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMVNF 620
Fly 621 EIAP 624 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 23/82 (28%) | ||
IGc2 | 449..511 | CDD:197706 | 20/61 (33%) | ||
IG_like | 544..612 | CDD:214653 | 21/67 (31%) | ||
Ig | 546..612 | CDD:143165 | 21/65 (32%) | ||
OLF | 694..937 | CDD:280371 | |||
Opcml | XP_006510497.1 | Ig | 44..132 | CDD:416386 | |
Ig strand A' | 44..49 | CDD:409353 | |||
Ig strand B | 51..59 | CDD:409353 | |||
CDR1 | 59..63 | CDD:409353 | |||
FR2 | 64..70 | CDD:409353 | |||
Ig strand C | 64..70 | CDD:409353 | |||
CDR2 | 71..83 | CDD:409353 | |||
Ig strand C' | 72..76 | CDD:409353 | |||
Ig strand C' | 80..83 | CDD:409353 | |||
FR3 | 84..118 | CDD:409353 | |||
Ig strand D | 87..94 | CDD:409353 | |||
Ig strand E | 97..103 | CDD:409353 | |||
Ig strand F | 110..118 | CDD:409353 | |||
CDR3 | 119..123 | CDD:409353 | |||
Ig strand G | 123..132 | CDD:409353 | |||
FR4 | 125..132 | CDD:409353 | |||
Ig_3 | 135..206 | CDD:404760 | 25/80 (31%) | ||
Ig strand A | 135..138 | CDD:409353 | 2/2 (100%) | ||
Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 151..160 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 165..170 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 171..174 | CDD:409353 | 0/7 (0%) | ||
Ig strand F | 198..206 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 223..300 | CDD:404760 | 25/82 (30%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 3/5 (60%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 279..283 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 293..298 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 306..309 | CDD:409353 | 2/2 (100%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 49 | 1.000 | Domainoid score | I11709 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |