Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
Alignment Length: | 255 | Identity: | 67/255 - (26%) |
---|---|---|---|
Similarity: | 99/255 - (38%) | Gaps: | 58/255 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLR 493
Fly 494 FTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQS-------SATLECL 551
Fly 552 VEAFPEAIRYW----ERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNE 612
Fly 613 LNATMVNFEIAPQDPNSETPYVGNNMKVYGQRPPESECPVCDQCPDPSLYQCKDSILNNF 672 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 23/82 (28%) | ||
IGc2 | 449..511 | CDD:197706 | 21/61 (34%) | ||
IG_like | 544..612 | CDD:214653 | 20/78 (26%) | ||
Ig | 546..612 | CDD:143165 | 18/69 (26%) | ||
OLF | 694..937 | CDD:280371 | |||
Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | |
Ig strand A' | 40..46 | CDD:409353 | |||
IG_like | 41..129 | CDD:214653 | |||
Ig strand B | 48..56 | CDD:409353 | |||
CDR1 | 56..60 | CDD:409353 | |||
FR2 | 61..68 | CDD:409353 | |||
Ig strand C | 61..67 | CDD:409353 | |||
CDR2 | 69..79 | CDD:409353 | |||
Ig strand C' | 71..74 | CDD:409353 | |||
Ig strand C' | 76..79 | CDD:409353 | |||
FR3 | 80..115 | CDD:409353 | |||
Ig strand D | 84..91 | CDD:409353 | |||
Ig strand E | 94..100 | CDD:409353 | |||
Ig strand F | 107..115 | CDD:409353 | |||
CDR3 | 116..120 | CDD:409353 | |||
Ig strand G | 120..129 | CDD:409353 | |||
FR4 | 122..129 | CDD:409353 | |||
Ig strand A' | 139..144 | CDD:409353 | 0/4 (0%) | ||
IGc2 | 146..204 | CDD:197706 | 22/64 (34%) | ||
Ig strand B | 150..157 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 163..168 | CDD:409353 | 2/11 (18%) | ||
Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
Ig strand E | 180..186 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 193..200 | CDD:409353 | 2/6 (33%) | ||
Ig_3 | 219..295 | CDD:404760 | 23/92 (25%) | ||
putative Ig strand A | 219..225 | CDD:409353 | 3/13 (23%) | ||
Ig strand B | 235..239 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 57 | 1.000 | Domainoid score | I10820 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |