DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and Olfml3

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001101178.1 Gene:Olfml3 / 310743 RGDID:1311106 Length:418 Species:Rattus norvegicus


Alignment Length:271 Identity:65/271 - (23%)
Similarity:109/271 - (40%) Gaps:28/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 YAVGKPVFHKVVNEKFGS----WLRDPSPDSDREKTFVTNENDPYNLFEFTTRIQYRMNSIPRRK 755
            |.:.:....|:: ::||.    |.:||.  ...||.:|.:.......|.|.....:.:....|:.
  Rat   149 YTISQVRSMKIL-KRFGGSAGLWTKDPL--GPAEKIYVLDGTQNDTAFVFPRLRDFTLTMAARKA 210

  Fly   756 YEIQEGFH--GNAHVVFNGSFYYQQR-------NSDLVVKLDLTSLKKITTQLPYAGVAAANRL- 810
            ..|:..|.  |...:|:.|..||.:|       ..:|...|.|.........:..:.|..|.|| 
  Rat   211 SRIRVPFPWVGTGQLVYGGFLYYARRPPGGAGGGGELENTLQLIKFHLANRTVVDSSVFPAERLI 275

  Fly   811 ----YTTDYNYMDFNVDEVGLWVIYSTYNSNNTL-VAKLDAETLKMQYNFNITLDHHQFGEMFIV 870
                .|.| .|:|...||.|||.:|:|...:..| :||||.:||..:..::...........|::
  Rat   276 PPYGLTVD-TYIDLAADEEGLWAVYATREDDRHLCLAKLDPQTLDTEQQWDTPCPRENAEAAFVI 339

  Fly   871 CGNLYAI-DSGTDKNTQIRYVVDLYKGKLLNTNLP---FSNPFSHTTTVGYNPLTVELYSWDKGN 931
            ||.||.: ::......:|:...|. .|.|......   |...:....::.|||...:||:||.|.
  Rat   340 CGTLYVVYNTRPASRARIQCSFDA-SGTLTPERAALSYFPRRYGAHASLRYNPRERQLYAWDDGY 403

  Fly   932 ALTYPIRYNEQ 942
            .:.|.:...::
  Rat   404 QIVYKLEMKKK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 65/264 (25%)
Olfml3NP_001101178.1 OLF 151..407 CDD:280371 63/260 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.