Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_218634.5 | Gene: | Iglon5 / 308557 | RGDID: | 1305344 | Length: | 336 | Species: | Rattus norvegicus |
Alignment Length: | 215 | Identity: | 63/215 - (29%) |
---|---|---|---|
Similarity: | 90/215 - (41%) | Gaps: | 33/215 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRR-EDGRTINVNGVEMASISGQFL 492
Fly 493 RFTNITRHQMAAYTCFANNGI--APVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAF 555
Fly 556 PEAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNATMVNF 620
Fly 621 EI---------APQDPNSET 631 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 30/85 (35%) | ||
IGc2 | 449..511 | CDD:197706 | 22/62 (35%) | ||
IG_like | 544..612 | CDD:214653 | 18/67 (27%) | ||
Ig | 546..612 | CDD:143165 | 18/65 (28%) | ||
OLF | 694..937 | CDD:280371 | |||
Iglon5 | XP_218634.5 | Ig | 41..129 | CDD:416386 | |
Ig strand A' | 41..46 | CDD:409353 | |||
Ig strand B | 48..56 | CDD:409353 | |||
CDR1 | 56..60 | CDD:409353 | |||
FR2 | 61..68 | CDD:409353 | |||
Ig strand C | 61..67 | CDD:409353 | |||
CDR2 | 69..79 | CDD:409353 | |||
Ig strand C' | 71..74 | CDD:409353 | |||
Ig strand C' | 76..79 | CDD:409353 | |||
FR3 | 80..115 | CDD:409353 | |||
Ig strand D | 84..91 | CDD:409353 | |||
Ig strand E | 94..100 | CDD:409353 | |||
Ig strand F | 107..115 | CDD:409353 | |||
CDR3 | 116..120 | CDD:409353 | |||
Ig strand G | 120..129 | CDD:409353 | |||
FR4 | 122..129 | CDD:409353 | |||
Ig strand A | 132..137 | CDD:409353 | 2/4 (50%) | ||
Ig_3 | 134..199 | CDD:404760 | 27/79 (34%) | ||
Ig strand A' | 140..145 | CDD:409353 | 2/9 (22%) | ||
Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 163..167 | CDD:409353 | 1/3 (33%) | ||
Ig strand D | 174..177 | CDD:409353 | 1/12 (8%) | ||
Ig strand E | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand F | 191..199 | CDD:409353 | 2/7 (29%) | ||
Ig_3 | 217..295 | CDD:404760 | 21/82 (26%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 234..238 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 57 | 1.000 | Domainoid score | I10613 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |