DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and Iglon5

DIOPT Version :10

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001419161.1 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:215 Identity:63/215 - (29%)
Similarity:90/215 - (41%) Gaps:33/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRR-EDGRTINVNGVEMASISGQFL 492
            :|..|.:|..|     |.|.||.::||.|.|.|.|.|.|.||: .||.|          ..|:.|
  Rat   131 VPARIVNISSP-----VAVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFT----------SEGEIL 180

  Fly   493 RFTNITRHQMAAYTCFANNGI--APVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAF 555
            ..::|.|.|...|.|..:||:  ||.:... ||.|.:.|.|:.......| ...:|.|.|...|.
  Rat   181 EISDIQRGQAGEYECVTHNGVNSAPDSRRV-LVTVNYPPTITDVTSARTA-LGRAALLRCEAMAV 243

  Fly   556 PEAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNATMVNF 620
            |.|...|.:  |.::|......|::...|  :|...|..:|:....:|.|.|.|.|.|.|:..:.
  Rat   244 PPADFQWYK--DDRLLSSGSAEGLKVQTE--RTRSMLLFANVSARHYGNYTCRAANRLGASSASM 304

  Fly   621 EI---------APQDPNSET 631
            .:         ||:.|...|
  Rat   305 RLLRPGSLENSAPRPPGPLT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 gly_rich_SclB <257..>409 CDD:468478
Ig 436..525 CDD:472250 32/91 (35%)
Ig strand B 453..457 CDD:409353 2/3 (67%)
Ig strand C 466..470 CDD:409353 1/3 (33%)
Ig strand E 490..494 CDD:409353 1/3 (33%)
Ig strand F 504..509 CDD:409353 2/4 (50%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Ig_3 529..611 CDD:464046 21/81 (26%)
OLF 694..939 CDD:460482
Iglon5NP_001419161.1 Ig 41..129 CDD:472250
Ig strand B 50..54 CDD:409382
Ig strand C 62..66 CDD:409382
Ig strand E 95..99 CDD:409382
Ig strand F 109..114 CDD:409382
Ig strand G 122..125 CDD:409382
Ig_3 134..199 CDD:464046 27/79 (34%)
Ig_3 217..295 CDD:464046 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.