Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038944182.1 | Gene: | Lsamp / 29561 | RGDID: | 71102 | Length: | 378 | Species: | Rattus norvegicus |
Alignment Length: | 211 | Identity: | 61/211 - (28%) |
---|---|---|---|
Similarity: | 95/211 - (45%) | Gaps: | 36/211 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLR 493
Fly 494 FTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSS-------ATLECL 551
Fly 552 VEAFPEAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNEL--- 613
Fly 614 NATMVNFE-IAPQDPN 628 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 24/82 (29%) | ||
IGc2 | 449..511 | CDD:197706 | 20/61 (33%) | ||
IG_like | 544..612 | CDD:214653 | 21/74 (28%) | ||
Ig | 546..612 | CDD:143165 | 20/65 (31%) | ||
OLF | 694..937 | CDD:280371 | |||
Lsamp | XP_038944182.1 | Ig | 55..145 | CDD:416386 | |
FR1 | 55..71 | CDD:409353 | |||
Ig strand A' | 56..62 | CDD:409353 | |||
Ig strand B | 64..72 | CDD:409353 | |||
CDR1 | 72..76 | CDD:409353 | |||
FR2 | 77..84 | CDD:409353 | |||
Ig strand C | 77..83 | CDD:409353 | |||
CDR2 | 85..95 | CDD:409353 | |||
Ig strand C' | 87..90 | CDD:409353 | |||
Ig strand C' | 92..95 | CDD:409353 | |||
FR3 | 96..131 | CDD:409353 | |||
Ig strand D | 100..107 | CDD:409353 | |||
Ig strand E | 110..116 | CDD:409353 | |||
Ig strand F | 123..131 | CDD:409353 | |||
CDR3 | 132..136 | CDD:409353 | |||
Ig strand G | 136..145 | CDD:409353 | |||
FR4 | 138..145 | CDD:409353 | |||
Ig_3 | 148..218 | CDD:404760 | 26/80 (33%) | ||
Ig strand A' | 155..160 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 166..173 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 179..184 | CDD:409353 | 1/4 (25%) | ||
Ig strand D | 190..193 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 197..203 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 210..217 | CDD:409353 | 2/6 (33%) | ||
Ig strand G | 224..232 | CDD:409353 | 1/7 (14%) | ||
Ig_3 | 235..311 | CDD:404760 | 24/89 (27%) | ||
Ig strand B | 252..256 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 265..269 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 290..294 | CDD:409353 | 1/6 (17%) | ||
Ig strand F | 304..309 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 318..321 | CDD:409353 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 57 | 1.000 | Domainoid score | I10613 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |