DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and RGD1310717

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001099757.1 Gene:RGD1310717 / 293288 RGDID:1310717 Length:521 Species:Rattus norvegicus


Alignment Length:287 Identity:69/287 - (24%)
Similarity:126/287 - (43%) Gaps:33/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   682 YPGLPKRPKTCY---LYAVGKPVFHKV----VNEKFGSWLRDPSPDSDREKTFVTNENDPYNLFE 739
            :||.|..|.:|.   |..|.:|:..|:    ::.|.|:|.||.:|:......:|.........|:
  Rat   198 HPGPPLAPGSCAHGGLQKVSRPLVVKLNWRGLSYKAGAWGRDSAPNPVSSLYWVAPLRADGRYFD 262

  Fly   740 FTTRIQYRMNS-----IPRRKYE-IQEGF-HGNAHVVFNGSFYYQQRNSDLVVKLDLTSLKKITT 797
            :     ||::.     :..:.|| .:.|: .|:.:.|:....|:....:..:.|:||:| ..:..
  Rat   263 Y-----YRLHKSYDDLVLLKHYEQWKMGYGDGSGNTVYKNFMYFNYYGTRYMAKVDLSS-NTLVL 321

  Fly   798 QLPYAGVAAANRLYTTDYNY-------MDFNVDEVGLWVIYSTYNS-NNTLVAKLDAETLKMQYN 854
            :.|..|....||     ::|       :||..||.||||.|:|..| .|.:|:.|:..||:::..
  Rat   322 RRPLPGATYNNR-----FSYACVPWTDIDFAGDEKGLWVFYATEESKGNLVVSLLNDSTLEVEQT 381

  Fly   855 FNITLDHHQFGEMFIVCGNLYAIDSGTDKNTQIRYVVDLYKGKLLNTNLPFSNPFSHTTTVGYNP 919
            :..:.........|:.||.|||:.|.:.:..:|.|..|...|:..:.::...........:.|.|
  Rat   382 WYTSQYKPALSGAFMACGVLYALRSLSTRQEEIFYAYDTTTGQEHHLSILLDKMLETLHGINYCP 446

  Fly   920 LTVELYSWDKGNALTYPIRYNEQRLIS 946
            ....||.::.|..:.|.:.:...:|.|
  Rat   447 WDHRLYVYNDGFLINYDLTFLTLKLPS 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 62/261 (24%)
RGD1310717NP_001099757.1 OLF 213..464 CDD:280371 62/261 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346534
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.