DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and DIP-lambda

DIOPT Version :10

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:269 Identity:84/269 - (31%)
Similarity:127/269 - (47%) Gaps:36/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 GINAWKLQYP----NGSSSN----------------DLLIPPSITDIQVPDFQ-RTVIVEEGRSL 453
            |.|.|||...    |.|.|.                |:::||.|  :..|:.. ...:.:||.|:
  Fly   111 GHNTWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDI--LNHPEHNPEDGVCQEGGSI 173

  Fly   454 NLSCTATGTPTPQVEWRREDGRTI--NVNGVE---MASISGQFLRFTNITRHQMAAYTCFANNGI 513
            :|.|:.||.|.|:|.||||.|:.|  ..:|.:   ..|:.|:.|..||:.|..|..|.|.|:|||
  Fly   174 SLMCSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGI 238

  Fly   514 APVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAIRYWERAYDGKI-LDPSDKY 577
            .|..:..:.|.|.|:|.:....|::.|..:...||||:||.||:.:..|.|: :|.| |...:||
  Fly   239 PPSVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRS-EGNIKLHNGNKY 302

  Fly   578 GI-ESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNAT-----MVNFEIAPQDPNSETPYVGN 636
            .| |.....:...:.|||.:|.|.|||.|.|.:.|.|..:     :....:.|:...:.||::..
  Fly   303 NISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQT 367

  Fly   637 NMKVYGQRP 645
            ..|...:.|
  Fly   368 TGKSRRKHP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 gly_rich_SclB <257..>409 CDD:468478
Ig 436..525 CDD:472250 33/94 (35%)
Ig strand B 453..457 CDD:409353 1/3 (33%)
Ig strand C 466..470 CDD:409353 1/3 (33%)
Ig strand E 490..494 CDD:409353 1/3 (33%)
Ig strand F 504..509 CDD:409353 2/4 (50%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Ig_3 529..611 CDD:464046 30/83 (36%)
OLF 694..939 CDD:460482
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 9/38 (24%)
Ig strand B 67..71 CDD:409353
Ig strand E 115..119 CDD:409353 3/3 (100%)
Ig strand F 129..134 CDD:409353 1/4 (25%)
Ig 153..250 CDD:472250 34/98 (35%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 3/14 (21%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 0/2 (0%)
IG_like 271..349 CDD:214653 29/78 (37%)
Ig strand B 271..275 CDD:409353 2/3 (67%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..320 CDD:409353 1/11 (9%)
Ig strand F 330..335 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.