DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and NEGR1

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:212 Identity:62/212 - (29%)
Similarity:89/212 - (41%) Gaps:35/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLR 493
            :||.|.||     ...:.|.||.::.|:|.|||.|.|.:.||       :::.......:||:|.
Human   137 VPPKIYDI-----SNDMTVNEGTNVTLTCLATGKPEPSISWR-------HISPSAKPFENGQYLD 189

  Fly   494 FTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQS-------SATLECL 551
            ...|||.|...|.|.|.|.::........|.|.|||.|.        |.:|       |..:.|.
Human   190 IYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQ--------EIKSGTVTPGRSGLIRCE 246

  Fly   552 VEAFPEAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNAT 616
            ....|.....|   |.|:....:.:.||  ..:.|.|...||::|:.::.||.|.|||.|:|..|
Human   247 GAGVPPPAFEW---YKGEKKLFNGQQGI--IIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTT 306

  Fly   617 MVNFEIAPQDPNSETPY 633
            ..:.   |.:|.|...|
Human   307 NASL---PLNPPSTAQY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 24/82 (29%)
IGc2 449..511 CDD:197706 21/61 (34%)
IG_like 544..612 CDD:214653 20/74 (27%)
Ig 546..612 CDD:143165 18/65 (28%)
OLF 694..937 CDD:280371
NEGR1NP_776169.2 IG 47..135 CDD:214652
IGc2 152..210 CDD:197706 22/64 (34%)
Ig_3 225..301 CDD:372822 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10858
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.