DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and Olfml1

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_766495.1 Gene:Olfml1 / 244198 MGIID:2679264 Length:233 Species:Mus musculus


Alignment Length:73 Identity:19/73 - (26%)
Similarity:34/73 - (46%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 GSWLRDPSPDSDREKTFVTNENDPYNLFEFTTRIQYRMNSIP--RRKYEIQEGFHGNAHVVFNG- 772
            |||::|...:|.:......:.|:  .::||.....:..:||.  .||..:...:.|:..||:.. 
Mouse   162 GSWMKDAGSNSAKVYLLAGSRNN--TVWEFANLRAFMEDSIKPGPRKLILPLSWQGSGQVVYQSF 224

  Fly   773 SFYYQQRN 780
            .|:.|.||
Mouse   225 LFFSQSRN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 19/73 (26%)
Olfml1NP_766495.1 OLF 145..>227 CDD:295358 15/66 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.