DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and Myoc

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_034995.3 Gene:Myoc / 17926 MGIID:1202864 Length:490 Species:Mus musculus


Alignment Length:321 Identity:89/321 - (27%)
Similarity:146/321 - (45%) Gaps:28/321 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 PESECPVCDQCP----------DPSLYQCKDSILNNFEIQATGNL--SYPGLPKR---PKTC-YL 694
            |.::.|..|..|          |...:|...|.|.  |:.|:..|  :..|.|:.   .|.| .|
Mouse   172 PSTQYPSQDMLPGSREVSQWNLDTLAFQELKSELT--EVPASQILKENPSGRPRSKEGDKGCGAL 234

  Fly   695 YAVGKPV---FHKVVNEKFGSWLRDPSPDS--DREKTF--VTNENDPYNLFEFTTRIQYRMNSIP 752
            ..||:||   ..:.:..|:|.|:|||.|..  .:|.|:  .|...:...:||::...|:. ...|
Mouse   235 VWVGEPVTLRTAETIAGKYGVWMRDPKPTHPYTQESTWRIDTVGTEIRQVFEYSQISQFE-QGYP 298

  Fly   753 RRKYEIQEGFHGNAHVVFNGSFYYQQRNSDLVVKLDL-TSLKKITTQLPYAGVAAANRLYTTDYN 816
            .:.:.:.........||:.||.|:|...|..||:.:| |...|...::|.||...........|.
Mouse   299 SKVHVLPRALESTGAVVYAGSLYFQGAESRTVVRYELDTETVKAEKEIPGAGYHGHFPYAWGGYT 363

  Fly   817 YMDFNVDEVGLWVIYSTYNSNNTLV-AKLDAETLKMQYNFNITLDHHQFGEMFIVCGNLYAIDSG 880
            .:|..|||.||||||||..:...:| :||:...|:::..:...:........|::||.||.:.|.
Mouse   364 DIDLAVDESGLWVIYSTEEAKGAIVLSKLNPANLELERTWETNIRKQSVANAFVICGILYTVSSY 428

  Fly   881 TDKNTQIRYVVDLYKGKLLNTNLPFSNPFSHTTTVGYNPLTVELYSWDKGNALTYPIRYNE 941
            :..:..:.:..|...|......:||:|.:.:::.:.||||..:|::||..|.:||.|:..|
Mouse   429 SSAHATVNFAYDTKTGTSKTLTIPFTNRYKYSSMIDYNPLERKLFAWDNFNMVTYDIKLLE 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 72/251 (29%)
MyocNP_034995.3 RILP-like <97..176 CDD:304877 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..184 3/11 (27%)
OLF 232..489 CDD:128580 73/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5381
eggNOG 1 0.900 - - E1_KOG3545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3311
SonicParanoid 1 1.000 - - X205
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.