DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and rig-5

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:284 Identity:80/284 - (28%)
Similarity:121/284 - (42%) Gaps:39/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 NAWKLQYPNGSSSN--------------------DLLIPPSITDIQVPDFQRTVIVEEGRSLNLS 456
            |.|.|...|...|:                    |:.:|| :.....|   ..|.|.||.:::|:
 Worm   152 NEWVLTIKNVQESDRGNYSCQINTEPITLSTGELDVKVPP-VVSRSTP---AAVEVREGNNVSLT 212

  Fly   457 CTATGTPTPQVEWRREDGRTINVNGVEMASIS---GQFLRFTNITRHQMAAYTCFANNGIAPVAN 518
            |.|.|.|||.|.|||:|.:.|..||......|   |..|..|.::|..|:.|.|.|:|||.|..:
 Worm   213 CKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDES 277

  Fly   519 ATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAIRYWERAYDGKILDPSDKYGIESYP 583
            .|..:.|.|.|::....:.:.|...|.|.:.|..||:|.....||:  ||:.:..|:...:....
 Worm   278 WTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEK--DGEPVYESNNVAMTHTV 340

  Fly   584 EG-FKTTMRLTISNLRKDDFGYYHCVARNE--LNATMVNFEIAPQDPNSETPYVGNNMKVYGQRP 645
            .| :.:...|.|.|::...||.|.|||:|:  ::.:.|..     :..|...:..:|:...|...
 Worm   341 SGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTL-----NQISHNHFTNSNLIPEGSGM 400

  Fly   646 PE--SECPVCDQCPDPSLYQCKDS 667
            |.  ||....|:..|....|..||
 Worm   401 PRGYSEDDEADEEEDNLENQKNDS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 33/85 (39%)
IGc2 449..511 CDD:197706 26/64 (41%)
IG_like 544..612 CDD:214653 21/68 (31%)
Ig 546..612 CDD:143165 20/66 (30%)
OLF 694..937 CDD:280371
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 6/36 (17%)
Ig_3 191..270 CDD:372822 30/82 (37%)
IG 294..380 CDD:214652 24/87 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.