DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and OLFM3

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:NP_001275750.1 Gene:OLFM3 / 118427 HGNCID:17990 Length:478 Species:Homo sapiens


Alignment Length:325 Identity:76/325 - (23%)
Similarity:136/325 - (41%) Gaps:54/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   651 PVCDQCPDPS--LYQCKDSILNNFEI-----QATGNLSYPGLPKR-------------PKTC-YL 694
            ||.:|....:  :.|.|:.|.|...:     :..|...|..|.:|             ..|| .|
Human   158 PVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKL 222

  Fly   695 YAVGKPVFHKVVNEKFGSWLRDPSPDSDREKTFVTNENDPYNLFEFTTRIQYRMNSIPR------ 753
            ..:..||..|....:||:|:.||.......:.:..:              .|..|.|.|      
Human   223 MKITGPVTVKTSGTRFGAWMTDPLASEKNNRVWYMD--------------SYTNNKIVREYKSIA 273

  Fly   754 --------RKYEIQEGFHGNAHVVFNGSFYYQQRNSDLVVKLDLTSLKKITTQ--LPYAGVAAAN 808
                    |.|.:...:.|..|||:|||.|:.:..|::::|... .:.::..|  |.|||.....
Human   274 DFVSGAESRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSF-DMGRVLAQRSLEYAGFHNVY 337

  Fly   809 RLYTTDYNYMDFNVDEVGLWVIYST-YNSNNTLVAKLDAETLKMQYNFNITLDHHQFGEMFIVCG 872
            ......::.:|...||:|||.:|:| .|:.|.::::|:.:||::..:::........||.|::||
Human   338 PYTWGGFSDIDLMADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICG 402

  Fly   873 NLYAIDSGTDKNTQIRYVVDLYKGKLLNTNLPFSNPFSHTTTVGYNPLTVELYSWDKGNALTYPI 937
            .||..:|.. ...::.|...........|::||.|.:.|.:.:.||.....||:|:.|:.:.:.:
Human   403 TLYVTNSHL-TGAKVYYSYSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNV 466

  Fly   938  937
            Human   467  466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 63/259 (24%)
OLFM3NP_001275750.1 Noelin-1 46..145 CDD:403504
PRK03918 <81..>217 CDD:235175 11/58 (19%)
OLF 222..466 CDD:396664 63/259 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5353
eggNOG 1 0.900 - - E1_KOG3545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X205
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.