DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and olfml2b

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_002933825.3 Gene:olfml2b / 100498044 XenbaseID:XB-GENE-960543 Length:763 Species:Xenopus tropicalis


Alignment Length:266 Identity:80/266 - (30%)
Similarity:123/266 - (46%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 LYAVGKPVFHKVVNEKFGSWLRDPSPDSDREKTFVTNENDPYNLFEFTTRIQYRM----NSIPRR 754
            |..:..|..........|:|::||.  :..||.:|||......|.||.....::.    ||    
 Frog   511 LSTISGPTTQNTYGRNEGAWMKDPL--AKDEKIYVTNYYYGNTLVEFRNLENFKQGRWSNS---- 569

  Fly   755 KYEIQEGFHGNAHVVFNGSFYYQQRNSDLVVKLDLTSLKKITTQLPYAGVAAANRLYTTDY---- 815
             |::...:.|..|||:||||||.:..:..::|.|          |.:..|||.:.|:...|    
 Frog   570 -YKLPYSWIGTGHVVYNGSFYYNRAFTRNIIKYD----------LKHRYVAAWSMLHDVVYEEST 623

  Fly   816 -------NYMDFNVDEVGLWVIYST-----YNSNNTLVAKLDAE--TLKMQYNFNITLDHHQFGE 866
                   :.:||.|||.||||||..     :.....:::||::.  |.:.:..:...|....:|.
 Frog   624 PWRWRGHSDIDFAVDENGLWVIYPAIDDEGFQQEVIVLSKLNSVDLTTQKETTWRTGLRKDFYGN 688

  Fly   867 MFIVCGNLYAIDSGTDKNTQIRYVVDLYKGKLLNTNLPFSNPFSHTTTVGYNPLTVELYSWDKGN 931
            .|::||.|||:||...||..|.|..|.:....:...|.|.|.:|:||.:.|||....||:||.|:
 Frog   689 CFVICGVLYAVDSYNKKNANISYAFDTHTNTQIVPRLLFVNEYSYTTQIDYNPKDRLLYTWDNGH 753

  Fly   932 ALTYPI 937
            .:||.:
 Frog   754 QVTYDV 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 80/264 (30%)
olfml2bXP_002933825.3 OLF 511..759 CDD:396664 80/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X205
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.