DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and ntm

DIOPT Version :10

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:249 Identity:73/249 - (29%)
Similarity:110/249 - (44%) Gaps:54/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWR----------REDGRTINVNGVE 483
            :||.|.||     ..::.|.||.:::|.|.|.|.|.|.|.||          .||          
 Frog   135 VPPRIVDI-----SSSIAVNEGSNVSLICIANGRPEPVVNWRYLSPKARGFVSED---------- 184

  Fly   484 MASISGQFLRFTNITRHQMAAYTCFANNGI-APVANATYLVEVQFAPMISVYRQMIYAEYQSSAT 547
                  ::|..|.|||.|...|.|.|:|.: ||......|. |.:.|.| :..|.|.|.......
 Frog   185 ------EYLEITGITREQSGIYECSASNDVSAPDVRRVKLT-VNYPPYI-LDAQNIGAPLGHRGI 241

  Fly   548 LECLVEAFPEAIRYWERAYDGKILDPSDKY-GIESYPEGFKTTMRLTISNLRKDDFGYYHCVARN 611
            |:|...|.|.|..:|.:  :.|.|  ||.: |::  .|..:|..|:|..|:.:.|:|.|.|:|:|
 Frog   242 LQCEASAVPAADFFWYK--EDKRL--SDSWRGVK--VENRETISRVTFLNVSEQDYGNYTCMAKN 300

  Fly   612 EL---NATMVNFEI-----AP--QDPNSE--TPYVGNNMKVYGQRPPESECPVC 653
            .|   ||:::.||:     :|  |:.::.  ||..|.. .|:......::|..|
 Frog   301 LLGHSNASIILFELFQSTSSPLLQEESTAALTPLKGPG-AVHDGNSGSTQCSFC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 gly_rich_SclB <257..>409 CDD:468478
Ig 436..525 CDD:472250 28/99 (28%)
Ig strand B 453..457 CDD:409353 1/3 (33%)
Ig strand C 466..470 CDD:409353 1/3 (33%)
Ig strand E 490..494 CDD:409353 1/3 (33%)
Ig strand F 504..509 CDD:409353 2/4 (50%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Ig_3 529..611 CDD:464046 26/82 (32%)
OLF 694..939 CDD:460482
ntmXP_004916061.1 Ig 45..133 CDD:472250
Ig strand B 54..58 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 99..103 CDD:409353
Ig strand F 113..118 CDD:409353
Ig strand G 126..129 CDD:409353
Ig_3 136..206 CDD:464046 28/90 (31%)
ig 227..311 CDD:395002 28/89 (31%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.