DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and ntm

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:249 Identity:73/249 - (29%)
Similarity:110/249 - (44%) Gaps:54/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWR----------REDGRTINVNGVE 483
            :||.|.||     ..::.|.||.:::|.|.|.|.|.|.|.||          .||          
 Frog   135 VPPRIVDI-----SSSIAVNEGSNVSLICIANGRPEPVVNWRYLSPKARGFVSED---------- 184

  Fly   484 MASISGQFLRFTNITRHQMAAYTCFANNGI-APVANATYLVEVQFAPMISVYRQMIYAEYQSSAT 547
                  ::|..|.|||.|...|.|.|:|.: ||......|. |.:.|.| :..|.|.|.......
 Frog   185 ------EYLEITGITREQSGIYECSASNDVSAPDVRRVKLT-VNYPPYI-LDAQNIGAPLGHRGI 241

  Fly   548 LECLVEAFPEAIRYWERAYDGKILDPSDKY-GIESYPEGFKTTMRLTISNLRKDDFGYYHCVARN 611
            |:|...|.|.|..:|.:  :.|.|  ||.: |::  .|..:|..|:|..|:.:.|:|.|.|:|:|
 Frog   242 LQCEASAVPAADFFWYK--EDKRL--SDSWRGVK--VENRETISRVTFLNVSEQDYGNYTCMAKN 300

  Fly   612 EL---NATMVNFEI-----AP--QDPNSE--TPYVGNNMKVYGQRPPESECPVC 653
            .|   ||:::.||:     :|  |:.::.  ||..|.. .|:......::|..|
 Frog   301 LLGHSNASIILFELFQSTSSPLLQEESTAALTPLKGPG-AVHDGNSGSTQCSFC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 27/93 (29%)
IGc2 449..511 CDD:197706 22/71 (31%)
IG_like 544..612 CDD:214653 21/68 (31%)
Ig 546..612 CDD:143165 21/66 (32%)
OLF 694..937 CDD:280371
ntmXP_004916061.1 Ig 45..133 CDD:299845
IG_like 45..133 CDD:214653
IG_like 143..220 CDD:214653 27/93 (29%)
IGc2 150..209 CDD:197706 23/74 (31%)
ig 227..311 CDD:278476 28/89 (31%)
IG_like 230..311 CDD:214653 28/86 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.