DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and myoc

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_002934195.3 Gene:myoc / 100489733 XenbaseID:XB-GENE-6258532 Length:499 Species:Xenopus tropicalis


Alignment Length:351 Identity:95/351 - (27%)
Similarity:154/351 - (43%) Gaps:46/351 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   624 PQDPNSETPYVGNNMKVYGQRPPESECPVCDQCP---------DPSLYQCKDSILNNF------- 672
            ||.|.|......::.|.   |.|::......|.|         ||..||...|.|...       
 Frog   161 PQVPGSSRAQAADSSKT---RVPDTSRVKDQQAPSRQVSRWGADPVGYQELKSELTALPASRMIP 222

  Fly   673 EIQATGNLSYPGLPKRPKTC-YLYAVGKPVFHKVVNE---KFGSWLRDPSPDSDREKTFVTNEN- 732
            |.|:|.:.|  ...:....| .|..:|:|..::..:.   |:|.|::||.|.:......|...| 
 Frog   223 ETQSTNHSS--ETIRADGACGELTWIGEPTTYRKADNIAGKYGVWMKDPKPLAPYTLDTVWRVNT 285

  Fly   733 ---DPYNLFEFTTRIQYRMNSIPRRKYEIQEGFHGNAHVVFNGSFYYQQRNSDLVVKLDL-TSLK 793
               |...:||: ..|...:...|.:.|.:......|..||:.||.||.:|.|.::||.|. |...
 Frog   286 VGADIRQVFEY-ENIDQLIKGYPGKVYVLPRSMESNGAVVYKGSLYYPRRKSRILVKYDFKTESV 349

  Fly   794 KITTQLPYAGVAAANRLYTTDYNY-------MDFNVDEVGLWVIYSTYNSNNTLV-AKLDAETLK 850
            .:..::|.||       |...|.|       :|..||||||||||||..:..::| :.||:|:|:
 Frog   350 AVQREIPNAG-------YQGQYPYSWGGYTDIDLAVDEVGLWVIYSTEKAKGSIVLSLLDSESLE 407

  Fly   851 MQYNFNITLDHHQFGEMFIVCGNLYAIDSGTDKNTQIRYVVDLYKGKLLNTNLPFSNPFSHTTTV 915
            ::.::...:........|::||.||.:.|.:..:|.:.:..|...|......:||.|.:.:.:.:
 Frog   408 VKQSWETQIRKQSVANAFMICGTLYTVGSYSSSSTTVNFAFDTSTGVQRPVGIPFKNQYGYASMI 472

  Fly   916 GYNPLTVELYSWDKGNALTYPIRYNE 941
            .|||...::|.||..|.:.|.:|.::
 Frog   473 DYNPTEKKIYGWDNFNMVAYDVRLSK 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653
IGc2 449..511 CDD:197706
IG_like 544..612 CDD:214653
Ig 546..612 CDD:143165
OLF 694..937 CDD:280371 74/258 (29%)
myocXP_002934195.3 OLF 243..494 CDD:396664 74/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto105521
Panther 1 1.100 - - O PTHR23192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X205
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.