Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002938252.1 | Gene: | iglon5 / 100488314 | XenbaseID: | XB-GENE-945713 | Length: | 333 | Species: | Xenopus tropicalis |
Alignment Length: | 201 | Identity: | 52/201 - (25%) |
---|---|---|---|
Similarity: | 85/201 - (42%) | Gaps: | 27/201 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 436 IQVP----DFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLRFTN 496
Fly 497 ITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQS----SATLECLVEAFPE 557
Fly 558 AIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNATMVNFE- 621
Fly 622 IAPQDP 627 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 24/82 (29%) | ||
IGc2 | 449..511 | CDD:197706 | 20/61 (33%) | ||
IG_like | 544..612 | CDD:214653 | 16/71 (23%) | ||
Ig | 546..612 | CDD:143165 | 15/65 (23%) | ||
OLF | 694..937 | CDD:280371 | |||
iglon5 | XP_002938252.1 | Ig | 31..123 | CDD:299845 | 52/201 (26%) |
IG_like | 35..123 | CDD:214653 | 52/201 (26%) | ||
Ig | 126..207 | CDD:299845 | 25/89 (28%) | ||
I-set | 128..207 | CDD:254352 | 24/87 (28%) | ||
I-set | 210..299 | CDD:254352 | 21/97 (22%) | ||
Ig | 227..298 | CDD:143165 | 17/74 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |