DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6867 and iglon5

DIOPT Version :9

Sequence 1:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:201 Identity:52/201 - (25%)
Similarity:85/201 - (42%) Gaps:27/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 IQVP----DFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQFLRFTN 496
            :|||    :...:|.|.||.::||.|.|.|.|.|.:.|::..         |..|..|:.|..|.
 Frog   123 VQVPAKIVNISSSVTVNEGSNVNLQCLAVGKPEPTITWQQLS---------EGFSSEGELLEITE 178

  Fly   497 ITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQS----SATLECLVEAFPE 557
            |.|.|...|.|..:||::........:.|.:.|.|:..:..     ||    .|||.|...|.|.
 Frog   179 INRQQAGDYECVTSNGVSVPDTKKVQITVNYPPYITDVKNA-----QSPVGRPATLRCKAMAVPP 238

  Fly   558 AIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNATMVNFE- 621
            |...|.:....:::..::...|::.    .:...:..||:....:|.|.|:|.|:|.:...:.. 
 Frog   239 AEFEWYKDEKRRLISGTEGLSIKTE----SSWSVIVFSNVTSRHYGNYTCLASNKLGSFNSSLRL 299

  Fly   622 IAPQDP 627
            :.|.||
 Frog   300 LKPGDP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 24/82 (29%)
IGc2 449..511 CDD:197706 20/61 (33%)
IG_like 544..612 CDD:214653 16/71 (23%)
Ig 546..612 CDD:143165 15/65 (23%)
OLF 694..937 CDD:280371
iglon5XP_002938252.1 Ig 31..123 CDD:299845 52/201 (26%)
IG_like 35..123 CDD:214653 52/201 (26%)
Ig 126..207 CDD:299845 25/89 (28%)
I-set 128..207 CDD:254352 24/87 (28%)
I-set 210..299 CDD:254352 21/97 (22%)
Ig 227..298 CDD:143165 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.