Sequence 1: | NP_573262.2 | Gene: | CG6867 / 32782 | FlyBaseID: | FBgn0030887 | Length: | 949 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031751462.1 | Gene: | lsamp / 100124984 | XenbaseID: | XB-GENE-5759171 | Length: | 368 | Species: | Xenopus tropicalis |
Alignment Length: | 216 | Identity: | 58/216 - (26%) |
---|---|---|---|
Similarity: | 90/216 - (41%) | Gaps: | 19/216 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 IPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISG--QF 491
Fly 492 LRFTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFP 556
Fly 557 EAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNATMVNF- 620
Fly 621 ---EIAPQDPNSETPYVGNNM 638 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6867 | NP_573262.2 | Collagen | 306..364 | CDD:189968 | |
IG_like | 442..525 | CDD:214653 | 25/84 (30%) | ||
IGc2 | 449..511 | CDD:197706 | 21/63 (33%) | ||
IG_like | 544..612 | CDD:214653 | 17/67 (25%) | ||
Ig | 546..612 | CDD:143165 | 17/65 (26%) | ||
OLF | 694..937 | CDD:280371 | |||
lsamp | XP_031751462.1 | Ig | 38..128 | CDD:416386 | |
FR1 | 38..54 | CDD:409353 | |||
Ig strand A' | 39..45 | CDD:409353 | |||
Ig strand B | 47..55 | CDD:409353 | |||
CDR1 | 55..59 | CDD:409353 | |||
FR2 | 60..67 | CDD:409353 | |||
Ig strand C | 60..66 | CDD:409353 | |||
CDR2 | 68..78 | CDD:409353 | |||
Ig strand C' | 70..73 | CDD:409353 | |||
Ig strand C' | 75..78 | CDD:409353 | |||
FR3 | 79..114 | CDD:409353 | |||
Ig strand D | 83..90 | CDD:409353 | |||
Ig strand E | 93..99 | CDD:409353 | |||
Ig strand F | 106..114 | CDD:409353 | |||
CDR3 | 115..119 | CDD:409353 | |||
Ig strand G | 119..128 | CDD:409353 | |||
FR4 | 121..128 | CDD:409353 | |||
Ig_3 | 131..206 | CDD:404760 | 26/82 (32%) | ||
Ig strand A' | 138..143 | CDD:409353 | 0/9 (0%) | ||
Ig strand B | 149..156 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 162..167 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 173..175 | CDD:409353 | 0/1 (0%) | ||
Ig strand E | 185..191 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 198..205 | CDD:409353 | 2/6 (33%) | ||
Ig strand G | 212..220 | CDD:409353 | 1/7 (14%) | ||
Ig_3 | 223..302 | CDD:404760 | 20/82 (24%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 240..244 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 281..285 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 295..300 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 308..311 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |