DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and KCNK17

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_113648.2 Gene:KCNK17 / 89822 HGNCID:14465 Length:332 Species:Homo sapiens


Alignment Length:161 Identity:41/161 - (25%)
Similarity:72/161 - (44%) Gaps:41/161 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 RTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGD---- 447
            |.|..|...|..|:.||.:..:|||....:           |..:.|::|.:|::|||:||    
Human   177 RWLAGSGALLSGLLLFLLLPPLLFSHMEGW-----------SYTEGFYFAFITLSTVGFGDYVIG 230

  Fly   448 MTP---VGVWGKIVGSLCAIAGVLTIALPVPVIVSNF-------NYFYHRETDQEEMQSQNFNH- 501
            |.|   ..:|.|.:.||..:.|:..:||.:.:|:|..       :..:|  :.:|:.:||::.. 
Human   231 MNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHH--SSKEDFKSQSWRQG 293

  Fly   502 ----------VTSCPYLPGTLG--QHMKKSS 520
                      ...| |..|.:|  ||::.|:
Human   294 PDREPESHSPQQGC-YPEGPMGIIQHLEPSA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 31/114 (27%)
KCNK17NP_113648.2 Ion_trans_2 81..157 CDD:462301
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:P57789 116..121
Ion_trans_2 <206..268 CDD:462301 20/72 (28%)
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:P57789 221..226 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..312 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.