DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and KCNK16

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001128577.1 Gene:KCNK16 / 83795 HGNCID:14464 Length:322 Species:Homo sapiens


Alignment Length:89 Identity:24/89 - (26%)
Similarity:41/89 - (46%) Gaps:30/89 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 RHSKGLQILGRTLKASMRELGLLIFFLFIG---VVLFSSAVYFAEAGSENSFFKSIPDAFWWAVV 438
            |.|:.||:||            |..||.:|   :::|...|:....|      .|..:.|::|.:
Human   162 RRSQVLQVLG------------LALFLTLGTLVILIFPPMVFSHVEG------WSFSEGFYFAFI 208

  Fly   439 TMTTVGYGD---------MTPVGV 453
            |::|:|:||         :||.|:
Human   209 TLSTIGFGDYVVGHPLNFITPSGL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 24/89 (27%)
KCNK16NP_001128577.1 Ion_trans_2 87..145 CDD:462301
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:P57789 108..113
Ion_trans_2 180..>219 CDD:462301 11/44 (25%)
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:P57789 212..217 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.