DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and TPK4

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_171752.1 Gene:TPK4 / 837846 AraportID:AT1G02510 Length:284 Species:Arabidopsis thaliana


Alignment Length:157 Identity:39/157 - (24%)
Similarity:67/157 - (42%) Gaps:48/157 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 EEEDTLN---LPKAPVSPQDKS----SNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLK 390
            |||:.||   |.....||::..    |....::.:|.:|                          
plant     2 EEENLLNENLLHPNESSPEETQVTTVSKSKWTILVLAMI-------------------------- 40

  Fly   391 ASMRELGLLIFFLFIGVVLFSSAVYFAE--AGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGV 453
                   ||:.:|..||..:|   :|.:  :|:|.:.|   .|||::::||.:||||||:.|...
plant    41 -------LLLVYLTFGVCTYS---FFRDQFSGTETNLF---VDAFYFSIVTFSTVGYGDIVPSTS 92

  Fly   454 WGKIVGSLCAIAGVLTIALPVPVIVSN 480
            ..||:..:....||:.:...:..:||:
plant    93 TTKILTIVLVSTGVVFLDYLLNRVVSH 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 39/157 (25%)
TPK4NP_171752.1 PRK10537 <36..>108 CDD:236711 28/110 (25%)
Ion_trans_2 160..233 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.