DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and KCO1

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:80 Identity:23/80 - (28%)
Similarity:40/80 - (50%) Gaps:10/80 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 RELGLLIFFLFIGVVLFSSAVYFAE---AGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWG 455
            |.:..|..:|.||.:.|    |...   :|.:.|   .:.||.::.:||||||||||:.|.....
plant    78 RVIMFLALYLTIGTLCF----YLVRDQISGHKTS---GVVDALYFCIVTMTTVGYGDLVPNSSAS 135

  Fly   456 KIVGSLCAIAGVLTI 470
            :::......:|::.:
plant   136 RLLACAFVFSGMVLV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 23/80 (29%)
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:462301 22/77 (29%)
Ion_trans_2 202..277 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.