DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and Kcnk16

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_083282.1 Gene:Kcnk16 / 74571 MGIID:1921821 Length:292 Species:Mus musculus


Alignment Length:117 Identity:34/117 - (29%)
Similarity:58/117 - (49%) Gaps:24/117 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 RHSKGLQILGRTLKASMRELGLLIFFLFIG--VVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVT 439
            |||:.||:||            |..||.:|  |:|....::|:..  |...|:   :.|::|.:|
Mouse   162 RHSQLLQVLG------------LALFLTLGTLVILIFPPMFFSHV--EGWSFR---EGFYFAFIT 209

  Fly   440 MTTVGYGDMT----PVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHR 487
            ::|:|:||..    |...:..:..||.||..:|.:|. :.|::|..:...||
Mouse   210 LSTIGFGDYVVGTDPSKHYIAVYRSLAAIWILLGLAW-LAVVLSLGSLLLHR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 34/117 (29%)
Kcnk16NP_083282.1 Ion_trans_2 87..145 CDD:462301
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:Q96T55 108..113
Ion_trans_2 180..248 CDD:462301 19/73 (26%)
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:Q96T55 212..217 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.