DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and Rpl37

DIOPT Version :9

Sequence 1:NP_001303569.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_080345.1 Gene:Rpl37 / 67281 MGIID:1914531 Length:97 Species:Mus musculus


Alignment Length:42 Identity:10/42 - (23%)
Similarity:15/42 - (35%) Gaps:9/42 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 HDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFD 134
            |..|.|    .....:..|..|..:     .|.||:|.|.::
Mouse    16 HTLCRR----CGSKAYHLQKSTCGK-----CGYPAKRKRKYN 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_001303569.1 BTB_2 99..187 CDD:280393 7/36 (19%)
BTB 99..182 CDD:197585 7/36 (19%)
Ion_trans 274..488 CDD:278921
Ion_trans_2 403..479 CDD:285168
Rpl37NP_080345.1 PTZ00073 1..88 CDD:240257 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.