DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and kcna7

DIOPT Version :9

Sequence 1:NP_001303569.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_701294.4 Gene:kcna7 / 572481 ZFINID:ZDB-GENE-120215-257 Length:233 Species:Danio rerio


Alignment Length:245 Identity:131/245 - (53%)
Similarity:168/245 - (68%) Gaps:25/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GLGEDRQHRKKQQQQQQHQKEQLEQKEEQKKIAERKLQLREQQLQRNSLDGYGSLPKLSSQDEEG 73
            |.||:..:.|.:.:.|..:    |..|..||:.:          |||..: .|...|...:.|..
Zfish     4 GEGEEESNSKMEDKTQTEE----EVSESDKKLKD----------QRNKAE-KGDKEKGEKKRENR 53

  Fly    74 GAGHGFGGGPQHFEPIPHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRN 138
            .:|..:.||          ....||:.|||||:|:|||:|||.||||:|||||.|||||||||||
Zfish    54 RSGSTWRGG----------WALSERLAINVSGMRYETQIRTLAQFPDSLLGDPRRRLRYFDPLRN 108

  Fly   139 EYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERP 203
            |.|.||:|..||||||:||||||||||.|||||||.:|::|||||:..:.:|:|||||.|||.||
Zfish   109 EIFLDRNRFCFDAILYFYQSGGRLRRPANVPLDVFMDELRFYELGEDIMARFKEDEGFPKEEPRP 173

  Fly   204 LPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFK 253
            ||::|.|||:|:|||:||||..||::|||||.||::||:||||||||:|:
Zfish   174 LPESEFQRKIWMLFEHPESSGGARIIAIISVMVIVVSILIFCLETLPDFR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_001303569.1 BTB_2 99..187 CDD:280393 66/87 (76%)
BTB 99..182 CDD:197585 63/82 (77%)
Ion_trans 274..488 CDD:278921
Ion_trans_2 403..479 CDD:285168
kcna7XP_701294.4 BTB_2 71..160 CDD:280393 66/88 (75%)
BTB 71..158 CDD:197585 66/86 (77%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D307298at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.