DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and kcnk5a

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001032478.2 Gene:kcnk5a / 570159 ZFINID:ZDB-GENE-051113-112 Length:513 Species:Danio rerio


Alignment Length:43 Identity:13/43 - (30%)
Similarity:23/43 - (53%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 PDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIAL 472
            |:|..:|...:||:|||::.|....|::   .|...|:..:.|
Zfish    86 PNAVIFAATVITTIGYGNIAPKTPSGRV---FCIFYGLFGVPL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 13/43 (30%)
kcnk5aNP_001032478.2 Ion_trans_2 77..137 CDD:462301 13/43 (30%)
Ion_trans_2 171..243 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.