DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and LOC567521

DIOPT Version :9

Sequence 1:NP_001303569.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_021332962.1 Gene:LOC567521 / 567521 -ID:- Length:561 Species:Danio rerio


Alignment Length:410 Identity:273/410 - (66%)
Similarity:327/410 - (79%) Gaps:24/410 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 ERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGR 161
            ::|||||||:.:||.|:|||||||||||||.:|:.||||:||||||||:|||||.|||:|||||:
Zfish   120 QKVVINVSGMMYETTLKTLNQFPDTLLGDPMKRIDYFDPMRNEYFFDRNRPSFDGILYFYQSGGK 184

  Fly   162 LRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAA 226
            :|||.|||||||::|:.||:||.:.:.:|||||||||:.|..||.:|..|:.||||||||||.||
Zfish   185 IRRPANVPLDVFADEMVFYQLGHEVMEQFREDEGFIKDPEPQLPTSELHRQFWLLFEYPESSSAA 249

  Fly   227 RVVAIISVFVILLSIVIFCLETLPEFKHYKVF-----NTT--TNGTKIEE---DEVPDITDPFFL 281
            |.||::|||||.:||.||||||||||:..:.|     |.|  .|||.:..   .::...|||||:
Zfish   250 RSVALVSVFVITISICIFCLETLPEFRDEREFVPAFVNLTRDANGTLLSRPRPHKISAFTDPFFV 314

  Fly   282 IETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLAT---VVAEEEDTLNLPKA 343
            :||:|||||.|||.|||:.||:|..|..::||||||::|:|||||:.|   ...|||:       
Zfish   315 VETVCIIWFCFELGVRFVVCPSKSEFFSNIMNVIDIVSIMPYFITVITELMATQEEEE------- 372

  Fly   344 PVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVV 408
                :|.::||.||||.||||||||||||||||||||||||||:||||||||||||||||||||:
Zfish   373 ----EDPTANQNMSLATLRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVI 433

  Fly   409 LFSSAVYFAEAGSDSSFFKSIPDGFWWAVVTMTTVGYGDMRPVGVWGKIVGSLCAIAGVLTIALP 473
            |||||:||||.....:.|.|||:|||||||||||||||||.|:.:.||:||.|||||||||||||
Zfish   434 LFSSAIYFAEVDEPDTQFVSIPEGFWWAVVTMTTVGYGDMCPITLGGKMVGILCAIAGVLTIALP 498

  Fly   474 VPVIVSNFNYFYHRETDQEE 493
            ||||||||||||||||:|.|
Zfish   499 VPVIVSNFNYFYHRETEQGE 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_001303569.1 BTB_2 99..187 CDD:280393 64/87 (74%)
BTB 99..182 CDD:197585 62/82 (76%)
Ion_trans 274..488 CDD:278921 152/216 (70%)
Ion_trans_2 403..479 CDD:285168 57/75 (76%)
LOC567521XP_021332962.1 BTB_2 122..213 CDD:308049 64/90 (71%)
Ion_trans 249..513 CDD:306908 179/274 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D307298at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.