DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and KCNQ2

DIOPT Version :9

Sequence 1:NP_001303569.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001369164.1 Gene:KCNQ2 / 3785 HGNCID:6296 Length:890 Species:Homo sapiens


Alignment Length:432 Identity:96/432 - (22%)
Similarity:161/432 - (37%) Gaps:113/432 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 IISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELT 295
            |...:|.||  |..|| .|..|...|.:..::.|.             .:::|.:.|:.|..|..
Human    94 IYHAYVFLL--VFSCL-VLSVFSTIKEYEKSSEGA-------------LYILEIVTIVVFGVEYF 142

  Fly   296 VRFLAC---------PNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKS 351
            ||..|.         ..:|.|.|....||||:.:|.....||.                    .|
Human   143 VRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASIAVLAA--------------------GS 187

  Fly   352 SNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYF 416
            .....:.:.||.:|.:::.|:.::.|.....::||..:.|..:||....:..|:.::|.|..||.
Human   188 QGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGFLCLILASFLVYL 252

  Fly   417 AEAGSDSSFFKSIPDGFWWAVVTMTTVGYGDMRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNF 481
            ||.| ::..|.:..|..||.::|:||:||||..|....|:::.:...:.||...|||..::.|.|
Human   253 AEKG-ENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGF 316

  Fly   482 NY---------------------------FYHRETDQEEMQS--QNFNHVTSCP-YLPGT----- 511
            ..                           ||.....:.::.|  |.:....:.| |...|     
Human   317 ALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYSSQTQTYGA 381

  Fly   512 -----------LGQHMK-KSSLS--------ESSSDMMDLDDGVESTPGLTETHPGRSAVAPFLG 556
                       |.:::| ||.|:        .|.|..:.|.|.|.|:|        |...|...|
Human   382 SRLIPPLNQLELLRNLKSKSGLAFRKDPPPEPSPSQKVSLKDRVFSSP--------RGVAAKGKG 438

  Fly   557 AQQQQQQPVASSLSMSIDKQLQHPLQQLTQTQLYQQQQQQQQ 598
            :.|.|    ....|.|.|:.|:....::.::..:..:.:.:|
Human   439 SPQAQ----TVRRSPSADQSLEDSPSKVPKSWSFGDRSRARQ 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_001303569.1 BTB_2 99..187 CDD:280393
BTB 99..182 CDD:197585
Ion_trans 274..488 CDD:278921 58/249 (23%)
Ion_trans_2 403..479 CDD:285168 26/75 (35%)
KCNQ2NP_001369164.1 Ion_trans 92..324 CDD:395416 67/266 (25%)
KCNQ_channel 448..669 CDD:397540 5/29 (17%)
KCNQ2_u3 684..774 CDD:406935
KCNQC3-Ank-G_bd 786..886 CDD:403240
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.